KEGG   Burkholderia sp. YI23: BYI23_B000120Help
Entry
BYI23_B000120     CDS       T01711                                 

Definition
(GenBank) chemotaxis-specific methylesterase
Organism
byi  Burkholderia sp. YI23
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:18071..19054
Genome map
AA seq 327 aa AA seqDB search
MKIGIVNDVPLAVEALRRALASRPDFEIAWIAHDGQQAIDYCAAHTPDVVLMDLVMPKVD
GVQASRTIMARSPCAILVVTVDVGANAWRVYEAMGAGALDAVDTPALAGSDARRGAAALI
GKIDQIGARLASSSVAIASKSSERLVAIGASAGGPSALATLLGALPKHFAAAIVIVQHVD
RAFAEGMAQWLDAQSALPVRIAREGDRPAPGVVLLAATNDHLHFASAGRLGYTAHPEQLP
YRPSVDVFFQSVTERWTGRALGVLLTGMGRDGAIGLKSMRAKGYHTIAQDEATSAVYGMP
KAAAALDAAVSILPLPRIAGAIATAFD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggcatcgtcaacgacgtcccgctcgccgtggaagcgctccggcgcgcgctc
gcttcgcggcccgacttcgagatcgcctggattgcgcacgacggccagcaggccatcgac
tattgcgcggcccacacgcccgatgtcgtgctgatggacctcgtgatgccgaaagtcgat
ggcgtgcaggcctcgcggaccatcatggcgcgttcgccgtgcgcgattctcgtcgtcacc
gtcgatgtcggcgcgaacgcgtggcgcgtctatgaagcgatgggcgcgggcgcgctcgac
gccgtcgatacccccgcgctcgcgggcagcgatgcgcggcgcggcgcggcggcgctgatc
ggcaagatcgatcagatcggcgcgcggctcgcttcgtccagcgtcgcgatcgcgtcgaag
agcagcgagcggctcgttgcgatcggcgcatcggcgggcgggccctccgcgctcgcgacg
ctgctcggcgcattgccgaagcatttcgcggcggccatcgtcatcgtgcagcacgtggat
cgcgccttcgcggaaggcatggcgcaatggctcgatgcgcaatcggcgctgccggtgcgc
atcgcgcgcgaaggcgacaggccggcgccgggcgtcgtgctgctcgccgcgaccaacgat
catctgcatttcgcctcggccggccgcctcggctataccgcgcatcccgagcaattgcct
taccggccttcggtcgacgtgttctttcagagcgtgaccgagcgctggacgggacgcgcg
ctcggcgtgcttttgaccggcatgggccgcgacggcgcgatcgggctgaagtcgatgcgc
gcgaaggggtatcacacgattgcgcaggacgaggcgacgagcgcggtctacggcatgccg
aaggccgcggccgcgctcgatgcggcggtttcgatcctgccgctgccgcgcatcgccggc
gcgatcgccacggcattcgactga

DBGET integrated database retrieval system