KEGG   Burkholderia sp. YI23: BYI23_B002720Help
Entry
BYI23_B002720     CDS       T01711                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
byi  Burkholderia sp. YI23
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BYI23_B002720
Enzymes [BR:byi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BYI23_B002720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(340852..341502)
Genome map
AA seq 216 aa AA seqDB search
MSAPRKNHLSGSDMPAEQADRPTREEAEAAVRVLLRWAGDDPRREGLLDTPARVVRAYEE
FFAGYTQSPHDILARTFSEVQGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNKRVV
GISKLARLVDAFAKRLQIQEKMTAQIADTLDEVLQPLGVGVILEAAHQCMSTRGVHKAGV
SMVTSRMLGSFRDDPSTRREFLSIVGNQTAFSVSNT
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccgcgcaaaaaccatctttcaggctcggacatgcctgctgaacaagccgat
cgtccgacccgcgaggaagccgaagccgccgtgcgtgtcctgctgcgctgggcaggcgac
gatccgcgccgcgaaggtctgctcgacaccccggcgcgcgtcgtgcgcgcgtatgaggag
ttctttgccggctacacgcagagcccgcacgacatcctcgcgcgcacgttttccgaggtg
cagggctatgacgaaatgatcgtcctgaaggatatccgcttcgaaagctattgcgagcat
cacatggtgccgatcatcggccgtgcgcatgtcgcgtatctgccgaacaaacgcgtggtc
ggcatatcgaagctcgcgcgtctcgtcgatgccttcgcgaaacgcctgcagattcaggag
aagatgaccgcgcagatcgcggacacgctcgacgaagtgctgcaaccgctcggcgtcggc
gtgattctcgaagcggcgcatcaatgcatgtcgacgcgcggcgtgcacaaggcgggcgtg
tcgatggtgacatcgcgcatgctcggctcgttccgcgacgatccgtcgacacgccgcgag
tttctttccatcgtcggcaatcagaccgcgttcagcgtgtcgaacacctga

DBGET integrated database retrieval system