KEGG   Burkholderia sp. YI23: BYI23_B004080Help
Entry
BYI23_B004080     CDS       T01711                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
byi  Burkholderia sp. YI23
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BYI23_B004080
Enzymes [BR:byi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BYI23_B004080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:497265..498272
Genome map
AA seq 335 aa AA seqDB search
MASMSSSVFPFSALVAQTPLQQALLLAAVDPSIGGVLVSGPRGTAKSTAARALAELLPEG
RLVTLPLGASEEQLIGTLDIQSALRDSAVRFSPGLLAKAHLGVLYVDEVNLLPNPLVDQL
LDVAASGVNIIERDGISHQHDARFVLIGTMNPEEGDLRPQLLDRFGLAVEMSNHFDASVR
QRIVKARLEFDMDAEVFRARHADEQASLVERIHAARASLSTFDFDDAVHARVSDLCIEAH
VDGLRADIVMLRAARALAALEGASRVCVTHVERVADAVLKHRRREAQADSEAPKNTADPT
PGDTNKGDADWGYMPPEPAGTAHVKSVRPLAAKKA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atagcatccatgtcctcttccgtatttcctttctccgcgctcgttgcgcaaacgccttta
cagcaggcgcttttgcttgcggcggtcgatccgtcgattggcggcgtgctcgtcagcggg
ccgcgcggcacggcgaaatcgacggcggcgcgcgcgctcgccgagttgctgcccgaagga
cggctcgtgacgctgccgctcggcgcaagcgaggagcaactcatcggcacgctggatatt
caaagcgcattgcgcgatagcgcggtgcgtttttctccgggcctgctcgcgaaagcgcat
ctcggcgtgctctatgtcgacgaggtcaatctgctgccgaatccgctcgtcgatcagttg
ctcgacgtcgcggcgagcggggtgaatatcatcgagcgcgatggcatctcgcatcagcat
gacgcgcgcttcgtcctgatcggcacgatgaatccggaagagggcgacttgcgtccgcag
ttgctggatcgcttcgggcttgctgtcgagatgagcaatcatttcgatgcgagcgtgcgg
cagcgcatcgtgaaggcgcgtctcgaattcgatatggatgccgaggtatttcgcgcgcgg
catgcagacgaacaggcttccttggtggagcgcattcacgcggcgcgcgcgtcgctctcc
acgttcgatttcgacgatgccgttcatgcgcgcgtaagtgatctttgcatcgaagcgcat
gtcgatggcttgcgcgcggatatcgtgatgctgcgtgcggcgcgggccctggccgcgctc
gaaggcgcatcgcgtgtttgtgtgacgcatgtcgaacgcgtcgccgatgccgtgttgaag
catcggcgtcgtgaagcgcaagccgattcggaagcgccgaaaaacacggcagatccgaca
ccgggcgatacaaacaaaggcgatgcggattggggttacatgccgcccgagccggcggga
accgcgcacgtcaaatcggtgaggccgctcgccgcaaaaaaagcctga

DBGET integrated database retrieval system