KEGG   Burkholderia sp. YI23: BYI23_B006770Help
Entry
BYI23_B006770     CDS       T01711                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
byi  Burkholderia sp. YI23
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BYI23_B006770
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BYI23_B006770
  Lipid metabolism
   00071 Fatty acid degradation
    BYI23_B006770
  Amino acid metabolism
   00350 Tyrosine metabolism
    BYI23_B006770
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BYI23_B006770
   00626 Naphthalene degradation
    BYI23_B006770
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BYI23_B006770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(788037..789032)
Genome map
AA seq 331 aa AA seqDB search
MRAMVFEGGAPRLHPRDLPDPSPRAGELLIDVHACGVCRTDLHVVDGELAHPKRPVIPGH
EIVGTVARLGAGVSGFSPGERVGVPWLGSTCGHCRYCASGRENLCDTPGFTGYTIDGGYA
ERVVADARYCLHLPDRYSDVEAAPLLCAGLIGYRTLAMAGDAQRIGIYGFGAAAHIVAQV
ARHQGRAVYAFTRPGDLAAQKLALDLNARWAGGSDEAPPEELDAALIFAPAGALVPVALR
AVAKGGAVVCGGIHMSDIPSFSYDLLWGERRVVSVANLTREDGRAFMRIAGEVHLDLHTT
CYALDDANAALDDLREGRVTGAAVLGVSLGT
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcaatggtcttcgagggcggcgcaccgcgcctgcatccgcgcgatctgccggac
ccgtcgccgcgtgcgggggaattgctcatcgacgtgcacgcgtgcggcgtgtgccgcacc
gatctgcatgtcgtcgatggggaactcgctcatccgaagcggccggtgattcccgggcat
gaaatcgtcgggacggtcgcgcggctcggcgcgggcgtgagcggcttttcgcccggcgag
cgcgtgggcgtgccgtggctcgggtcaacttgtggacattgccgctattgcgcgtcgggc
cgcgagaatctttgcgatacgccgggtttcacgggctatacgatcgacggcggctacgcg
gagcgcgtcgttgcggatgcgcgctattgcctgcacctgccggatcgctattcggacgtg
gaagcggccccgctgctgtgcgcgggactcatcggctatcgcacgctcgcgatggcgggc
gacgcgcaacgtatcggcatctatggtttcggcgctgcggcgcatatcgtggcgcaggtt
gcgcggcatcaggggcgtgcggtctatgcgttcacgcgtccgggcgatctcgccgcgcag
aagcttgcgctcgatctgaatgcgcgttgggcgggtgggagcgacgaggccccgcccgag
gagctcgatgccgcgctcatcttcgcgccggctggcgcgctcgtgcccgtggcgctcagg
gctgtggcgaagggtggggccgtagtgtgtggcggcatccacatgagtgatattccttcg
ttttcttatgatctgctgtggggggagcggcgtgtggtgtcggtcgcgaatctcacgcgt
gaggatgggcgggcgtttatgcgcatcgcgggggaggttcatctcgatttgcatacgacg
tgctatgcgctcgatgatgctaatgctgcgcttgatgatctgcgcgaagggagggtgacg
ggggctgcggtgttgggcgtttcgctgggaacttga

  All links  
No link information was found.   
DBGET integrated database retrieval system