KEGG   Burkholderia sp. YI23: BYI23_B007290Help
Entry
BYI23_B007290     CDS       T01711                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
byi  Burkholderia sp. YI23
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:byi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:byi00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:byi00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(847034..847855)
Genome map
AA seq 273 aa AA seqDB search
MSTASKARHKTHVTADKLAIKAERILAIDIGGTGLKAAIISEDGEMKSDRVRVATPHPAK
PDVVVETLIELVKPIVAEPPTHISIGFPGVVRDNVVVTAPNLGTTQWRGVPLAQLLAERL
GNVPARMINDADMQGLAAIEGRGIEMVLTLGTGAGTALFRDGELMPHLELAHHPVAKDKT
YDEYIGNAAREKAGKKRWSRRVEKIIGILATLVNYDRLWIGGGNAAHIKFKLPDNVAIVS
NAAGIEGGARLWHPRSVRETRQLPHFNQREGAN
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacagcatccaaagccagacacaagacgcacgtcaccgccgacaaactcgcgatc
aaggccgagcgcatcctcgcgatcgatatcggcgggaccgggctgaaggccgcgatcatc
tcggaagacggcgagatgaaaagcgatcgcgtgcgcgtggcgacgccgcatccggccaag
cccgacgtggtcgtcgagacgctgatcgagctggtgaagccgatcgtcgccgagccgccg
acgcatatttccatcggttttccgggcgtcgtgcgcgacaacgtggtcgtgaccgcgccg
aatctcggcaccacgcaatggcgcggcgtgccgctcgcgcagttgctcgccgaacggctc
ggcaacgtgcccgcgcgcatgatcaacgacgccgacatgcaggggctcgcggcaatcgaa
gggcgcggcatcgagatggtgctgacgctcgggaccggcgcgggcaccgcgcttttccgc
gatggcgagctgatgccgcatctggagctcgcgcatcatccggtcgcgaaggacaagacc
tacgacgaatatatcggcaacgcggcgcgggagaaggcgggcaagaagcgctggagccgg
cgcgtggaaaagatcatcggtattctcgcgacgctcgtgaactacgaccgtctgtggatc
ggcggcggcaatgcggcgcacatcaagttcaagctgcccgacaacgtggcgatcgtgtcg
aacgcggcgggcatcgaaggcggcgcgcggctgtggcatccgcgctcggtgcgcgagacg
cgccagttgccgcacttcaaccagcgtgaaggggcgaactga

DBGET integrated database retrieval system