KEGG   Burkholderia sp. YI23: BYI23_B007290Help
Entry
BYI23_B007290     CDS       T01711                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00010  Glycolysis / Gluconeogenesis
byi00520  Amino sugar and nucleotide sugar metabolism
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
byi01120  Microbial metabolism in diverse environments
byi01130  Biosynthesis of antibiotics
byi01200  Carbon metabolism
Module
byi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BYI23_B007290
   00520 Amino sugar and nucleotide sugar metabolism
    BYI23_B007290
Enzymes [BR:byi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BYI23_B007290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: AET91336
UniProt: G8MFK8
Position
2:complement(847034..847855)
Genome map
AA seq 273 aa AA seqDB search
MSTASKARHKTHVTADKLAIKAERILAIDIGGTGLKAAIISEDGEMKSDRVRVATPHPAK
PDVVVETLIELVKPIVAEPPTHISIGFPGVVRDNVVVTAPNLGTTQWRGVPLAQLLAERL
GNVPARMINDADMQGLAAIEGRGIEMVLTLGTGAGTALFRDGELMPHLELAHHPVAKDKT
YDEYIGNAAREKAGKKRWSRRVEKIIGILATLVNYDRLWIGGGNAAHIKFKLPDNVAIVS
NAAGIEGGARLWHPRSVRETRQLPHFNQREGAN
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacagcatccaaagccagacacaagacgcacgtcaccgccgacaaactcgcgatc
aaggccgagcgcatcctcgcgatcgatatcggcgggaccgggctgaaggccgcgatcatc
tcggaagacggcgagatgaaaagcgatcgcgtgcgcgtggcgacgccgcatccggccaag
cccgacgtggtcgtcgagacgctgatcgagctggtgaagccgatcgtcgccgagccgccg
acgcatatttccatcggttttccgggcgtcgtgcgcgacaacgtggtcgtgaccgcgccg
aatctcggcaccacgcaatggcgcggcgtgccgctcgcgcagttgctcgccgaacggctc
ggcaacgtgcccgcgcgcatgatcaacgacgccgacatgcaggggctcgcggcaatcgaa
gggcgcggcatcgagatggtgctgacgctcgggaccggcgcgggcaccgcgcttttccgc
gatggcgagctgatgccgcatctggagctcgcgcatcatccggtcgcgaaggacaagacc
tacgacgaatatatcggcaacgcggcgcgggagaaggcgggcaagaagcgctggagccgg
cgcgtggaaaagatcatcggtattctcgcgacgctcgtgaactacgaccgtctgtggatc
ggcggcggcaatgcggcgcacatcaagttcaagctgcccgacaacgtggcgatcgtgtcg
aacgcggcgggcatcgaaggcggcgcgcggctgtggcatccgcgctcggtgcgcgagacg
cgccagttgccgcacttcaaccagcgtgaaggggcgaactga

DBGET integrated database retrieval system