KEGG   Burkholderia sp. YI23: BYI23_B008380Help
Entry
BYI23_B008380     CDS       T01711                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
byi  Burkholderia sp. YI23
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BYI23_B008380
Enzymes [BR:byi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BYI23_B008380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:972516..973676
Genome map
AA seq 386 aa AA seqDB search
MRVSTAKVFAGALIAATATGAQATQAAQQCDWPAYRIFVERVVQADGRVIDRSTDAQQTT
SEGQSYGMFFALVANDRATFDRLFNWTRSNLSANQFDANTVRLPAWQWGKKPDGAFGVMD
PNSASDSDLWIAYDLFQAGRLWKEPMYTKLAFALATQIVKQEVVDLPGLGPMLLPGPHGF
RTGDVTRLNPSYLPLPLLRGLAHEMPDGPWAKLAQSAAKMIKVTSPHGYAPDWAAYQASP
NGQFVVDPKNGDIGSYDAIRVYLWAGMAPAGDPLARPWLDALSGMRQSVAQTGFPPEKVN
VTTGAASGEGPLSYWGALAPYFKALNDERGLGLARAHLEALSAPPGAGREPVYYDRVLGL
FGGGFVDGKYRFDENGRLVPNWRSAC
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtttcgaccgccaaagttttcgccggagcgctcatcgcggccacggccacgggc
gcgcaggccacacaggccgcgcagcagtgcgactggcccgcgtaccgcatcttcgtcgag
cgcgtcgtgcaggccgatggccgcgtgatcgaccgctccaccgacgcgcagcagaccacg
tccgaaggccagtcttacggcatgttcttcgcgctcgtcgcgaacgaccgcgccacgttc
gaccggctcttcaactggacgcgcagcaatctctccgcgaatcagttcgatgcgaacacc
gtgcgcctgcccgcgtggcaatggggcaaaaagccggacggcgcgttcggcgtgatggac
ccgaactcggcgtcggattcggatttgtggatcgcctacgacctctttcaggccggccgc
ctctggaaggagccgatgtacacgaagctcgccttcgcgctcgcgacgcagatcgtgaag
caggaagtcgtcgatctgccgggcctcgggccgatgctgctgcccggcccgcacggtttt
cgcaccggcgacgtgacgcgcctgaacccgagctatctgccgctgccgctcttgcgcggc
cttgcgcacgagatgcccgacggcccgtgggcgaagctcgcgcaaagcgccgcgaagatg
atcaaggtgacgtcgccgcacggctacgcgccggactgggcagcgtaccaggccagcccg
aacggccagttcgtcgtcgatccgaagaacggcgatatcggcagctacgatgcgatccgc
gtttatctgtgggccggcatggcgccggcgggcgatccgctcgcgcggccgtggctcgat
gcgctgtccggcatgcgccagagcgtcgcgcagacgggttttccgccggagaaagtcaac
gtgacgacgggcgcggcaagcggcgaaggtccgctttcctattggggcgcgctcgcgccg
tacttcaaggcgctgaacgacgagcgcggactgggcctcgcgcgcgcgcatctcgaagcg
ctcagcgcgccgccgggcgcgggacgcgagccggtctactacgaccgcgtgctcggactt
ttcggcggcggtttcgtcgacgggaaatatcgcttcgatgaaaacgggcgtctcgtgccg
aactggagaagcgcatgctga

DBGET integrated database retrieval system