KEGG   Burkholderia sp. YI23: BYI23_B008930Help
Entry
BYI23_B008930     CDS       T01711                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
byi  Burkholderia sp. YI23
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BYI23_B008930
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BYI23_B008930
Enzymes [BR:byi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BYI23_B008930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1029891..1031171
Genome map
AA seq 426 aa AA seqDB search
MTMTQQQTLLRDAMRRLNMTRDSFASRIGVSRRALDTWLLPDESPESRAMPEIAGRYVGE
ILSGMPENGGYTQSAYSAIDFEGRPQLLSIDQFSRESAEALFRTADMMQPIARRKKITRV
LEGAVLANLFFEASTRTRVSFGAAFARLGGSVCDTTGFTFSSMAKGESIYDTSRVISGYA
DAIVVRHPEQGSVAEFARATNIPVINAGDGPGEHPSQALLDLYTIQREFSRLGKIVDGAH
IAMVGDLKYGRTVHSLAKLLSLYKGLKFTLVSPRSLEMPAHIVERIARGDHVIEQTSDLR
AGLAGADVVYATRIQKERFADESIEGYTPDFQINQALVDDVCGRDTLIMHPLPRDSRPGA
NDLATDLNHDSRLAIFRQTDNGIAVRMAIFAVLLGVEHQVLHSMRDAAWKSPTSIGPDDA
VFHGFD
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatgacccagcagcagacccttcttcgcgacgcgatgcggcgtctgaacatgacg
cgcgattcgttcgcgtcgcgcatcggcgtgtcgcgccgcgcgctcgacacctggctgctg
ccggacgagtcgcccgagtcgcgcgccatgccggaaatcgcgggccgctatgtcggcgaa
attctctcgggtatgccggagaacggcggatatacgcagagcgcatattccgctatcgac
ttcgaaggccggccgcagttgctctccatcgaccagttttcgcgcgaatcggccgaggcg
ctgttccgcacggccgacatgatgcagccgatcgcgcggcgcaagaagatcacgcgcgtg
ctcgaaggcgccgtgctcgccaacctcttcttcgaagccagcacgcgcacccgcgtgagt
ttcggcgcggcgttcgcgcggctcggcggatcggtgtgcgacacgacgggcttcacgttt
tcgtcgatggcgaagggcgaatcgatctacgacacgagccgcgtgatcagcggttacgcc
gacgcgatcgtcgtgcggcatccggagcaaggctcggtcgccgagttcgcgcgcgcgacc
aacattcccgtgatcaacgccggcgacggccccggggagcatccgagccaggcgctgctc
gatctctacacgatccagcgcgagttttcgcgtctcgggaagatcgtcgacggcgcgcat
atcgcgatggtcggcgatctcaagtacgggcgcaccgtgcattccctcgccaagctgctt
tcgctctacaaggggctcaagttcacgctcgtgtcgccgcgctcgctggagatgccggcg
catatcgtcgagcgaatcgcgcgcggcgatcacgtgatcgaacaaacgagcgatttgcgc
gcgggcctcgcgggcgcggacgtggtctatgccacgcgcattcagaaagagcgtttcgcc
gacgagtcgatcgaaggatacacgccggatttccagatcaatcaggcgctcgtggacgac
gtgtgcggccgcgacacgctcatcatgcatcccctgccgcgcgacagccgccccggcgca
aacgatctcgcaaccgatctgaatcacgactcgcggctcgcgatcttccgccagaccgac
aacggcatcgcggtgcgcatggcgattttcgcggtgctgctgggcgtcgagcatcaggtg
ctgcattcgatgcgcgacgcggcgtggaaatcgcctacatcgatcggcccggacgatgcc
gtcttccacggcttcgattga

DBGET integrated database retrieval system