KEGG   Burkholderia sp. YI23: BYI23_B010420Help
Entry
BYI23_B010420     CDS       T01711                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
byi  Burkholderia sp. YI23
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BYI23_B010420
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BYI23_B010420
   00640 Propanoate metabolism
    BYI23_B010420
   00660 C5-Branched dibasic acid metabolism
    BYI23_B010420
Enzymes [BR:byi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BYI23_B010420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1192096..1193301
Genome map
AA seq 401 aa AA seqDB search
MNIHEYQAKALLRKYGVAVPEGRVAFSATEAADAASALGGPVWVVKSQIHAGGRGAGRFV
NDPDGKGGVRVVKSVDDVRDNAQKMLASVLVTKQTGPAGKEVKRLYIEEGCDIARELYLG
MLVDRATSRITIMASTEGGMEIEEVAHHTPEKILKVAIDPATGLQPFHTRQIAFGLGLTG
NQVKAASKFITALYQAFVDLDASIVEVNPLVVTGSGDVMALDAKLNFDDNALYRHPDIEK
LRDEDEEDPAEIEAAKHGLNYVKLDGNIGCMVNGAGLAMATMDIIKLYGGEPANFLDVGG
GATQERVATAFKLILRDPKVQGILVNIFGGIMRCDVIAQGVVAAAREVDLRVPLVVRLAG
TNVDAGREILRASGLAIIPAENLADAADKIVTAVAQGGTAK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaatatcaggcgaaggcgctgctgcgaaagtacggcgtcgcggttccg
gagggccgcgtcgccttttccgcgacggaggccgccgacgcggccagcgcgctgggcggc
ccggtctgggtcgtcaagtcgcagatccacgcgggcggccgcggcgcggggcgtttcgtc
aacgatccggacggtaaaggcggcgtgcgcgtcgtgaaatcggtcgatgacgtgcgcgac
aacgcgcagaaaatgctcgcgtcggtgctcgtgacgaagcagaccggacccgccggcaag
gaagtcaagcgtctctatatcgaggaaggctgcgatatcgcgcgcgaactgtatctcggc
atgctggtcgatcgcgccacgtcgcgcatcacgatcatggcgtcgaccgagggcggcatg
gaaatcgaggaagtcgcgcatcacacgccggagaagattctgaaggtcgcgatcgatccg
gccacggggcttcagccctttcacacgcgtcagatcgcgttcggactcgggctcaccggc
aatcaggtgaaggcggcgtcgaagttcatcacggcgctgtatcaggccttcgtcgatctg
gacgcgtcgatcgtcgaggtgaatccgctcgtcgtgaccggctccggcgacgtgatggcg
ctcgacgccaagctcaatttcgacgacaacgcgctgtatcgccatcccgacatcgaaaag
ctgcgcgacgaagacgaggaagatcccgccgaaatcgaagcggcgaaacacggcctcaat
tatgtgaagctcgacggcaacatcggctgcatggtgaacggcgcgggcctcgcgatggcc
acgatggacatcatcaagctctatggcggcgagcccgcgaactttctcgacgtcggcggc
ggcgcaacgcaggagcgcgtcgcgaccgcgttcaagctgatcctgcgcgatccgaaagtg
caagggattctcgtcaacatcttcggcggcatcatgcgctgcgacgtgatcgcgcaaggc
gtcgtcgcggcggcgcgcgaggtcgatctgcgcgtgccgctcgtcgtgcgcctcgccggc
acgaacgtcgatgcgggccgcgagattctgcgcgcgtccggcctcgccatcatccccgcc
gaaaacctcgccgatgccgccgacaagatcgtcacggccgtcgcccaaggaggaaccgcc
aaatga

DBGET integrated database retrieval system