KEGG   Burkholderia sp. YI23: BYI23_B011460Help
Entry
BYI23_B011460     CDS       T01711                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00500  Starch and sucrose metabolism
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
Module
byi_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BYI23_B011460
Enzymes [BR:byi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BYI23_B011460
Exosome [BR:byi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BYI23_B011460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AET91753
UniProt: G8MCD6
Position
2:1324775..1327000
Genome map
AA seq 741 aa AA seqDB search
MNNRSDPADTRNPAHGLNPLDIDALVEARHPDPFAMLGLHQTDLGHVVRVFLPGASSVSV
ADAGNGEHLGSLARIHDAGLYAGFVERPAAYRLQVDWHGTPQETHDTYSFGPVLSDEWLT
RLSQADPYAVLECLGSRPVTHGNVAGVRFAVWAPNARRVSVVGDFNTWDGRRHPMRMRHN
AGVWELFIPGIGAGTRYKYEIVTRDGHTLPLKADPCAMQSEKPPSTASVVADADAIDHYA
WTDAEWMATRGGKQTPQSPITIYEAHAESWLRVPEEGNRGMNWHELAERLIPYAKGMGFT
HLEFMPIAEHPFGGSWGYQPLGQFSPSARFGTPEQFAEFVNRAHEAGLGVIIDWVPAHFP
NDAHGLVEFDGTPLYEHADPREGYHQDWNTMIYNLGRNEVSAFLIASGLAWLKRYHIDGL
RVDAVASMLYRDYSRKAGEWVPNIYGGRENLESIAFLKRLNHEVRQIPGALTVAEESTAW
PGVTAPVENGGLGFDFKWNMGWMHDTLHYMQEDPVYRQYHHHLYTFGMVYAYSERFVLPL
SHDEVVHGKGSLINKMPGDRWQKFANLRAYFGFMWTHPGKKLLFMGGEFGQFAEFNHDES
PHWHLLDDALHGGLQRLVRDLNLLYTSEPALHKLDSDSRGFEWIVGDDNANSVYAYRRTD
AEGRELVVVCNMTPVPRQAYRIGLPQRGRWCEVFNSDASVYGGSNTGNGGVIHTDDYPSH
GKGQSAALTLPPLSTIVLRAD
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatcgtagcgatccggcggataccaggaatccggcgcacggtcttaatccgctc
gacatcgacgcactcgtcgaggcccggcatcccgatccgttcgcgatgctcggtctgcat
caaaccgatctcggccatgtcgtgcgcgtgtttctgcccggcgcatcgtcggtgagcgtc
gcggacgcgggcaatggcgagcatctcggctcgctcgcgcgcatccacgatgcggggctg
tacgcgggcttcgtggaaaggccggcggcgtatcgcctgcaggtcgactggcacggcacg
ccgcaggagacgcacgacacatattcgtttggccccgtgctcagcgatgaatggctcacg
cgcctctcgcaagcggacccgtatgcggtgctcgaatgcctgggctcgcgtccggtcacg
cacggcaacgttgcgggcgtgcgcttcgcggtatgggcgccgaacgcgcggcgcgtgtcc
gtggtgggcgacttcaacacatgggatggccggcgtcacccgatgcgcatgcggcacaac
gcgggcgtatgggagctgttcattccgggcatcggcgcgggcacgcgttacaagtacgag
atcgtcacgcgcgacggccatacgctgccgctgaaagccgatccttgcgcgatgcagagc
gagaagccgccatcgacggcatcggtcgtcgcggatgccgatgcgatcgaccactacgcg
tggaccgatgcggaatggatggccacgcgcggcggcaagcaaacgccgcaatcgccgatc
acgatttacgaggcgcatgcggaatcgtggctgcgcgtgcccgaagagggcaatcgtggc
atgaactggcacgagctcgcggagcgtttgattccgtatgcgaagggcatgggtttcacg
cacctcgaattcatgccgatcgccgagcatccgttcggcggctcgtggggttatcagccg
ctcgggcagttctcgccttccgcgcgcttcggcacacccgagcagttcgcggagttcgtg
aaccgcgcgcacgaagcgggtctgggcgtcatcatcgactgggtgccggcgcactttccg
aacgacgcgcacggactcgtggagttcgacggcacgcctttgtacgagcatgcggacccg
cgcgagggctatcaccaggactggaacacgatgatctacaacctcggccgcaacgaggtg
agcgcgttcctgatcgcgtcggggctggcgtggctgaagcgttatcacatcgatggattg
cgcgtcgatgcggtcgcttcgatgctgtatcgcgactattcgcgcaaggcgggcgagtgg
gtgccgaacatttacggcggacgcgagaacctcgaatccatcgccttcctgaagcgtctg
aatcatgaagtgcgacagattccgggcgcgctcacggtagccgaagaatccactgcgtgg
ccgggcgtgacggcgccggtcgagaacggcgggctcggtttcgacttcaagtggaacatg
ggctggatgcacgacacgctgcattacatgcaggaagatccggtttatcggcagtatcac
catcatctctatacgttcgggatggtgtatgcgtattccgagcgtttcgtgctgccgctt
tcgcacgatgaagtcgtgcacggcaaggggtcgctgatcaacaagatgccgggcgatcgc
tggcagaagttcgccaatctgcgggcgtatttcggcttcatgtggacgcatccgggcaag
aagctgttgtttatgggcggcgagttcggccagttcgcggaattcaatcacgatgaatcg
ccgcactggcatttgctcgacgatgccttgcatggcggattgcagagactcgtgcgagat
ttgaatctgctctatacgagcgagccggcgttgcacaagctcgacagcgattcgcgcggc
ttcgagtggatcgtgggggacgacaacgcgaatagcgtgtatgcgtatcggcgcacggat
gcggaaggccgcgagctggttgtggtgtgcaacatgacgccggtgccgcggcaggcttat
cggattgggttgccgcagcgcgggcgatggtgtgaggtttttaactccgatgcctcggtg
tatggcgggtcgaatactgggaacggtggggttattcatacggatgactatccgagtcat
gggaaggggcagtcagctgcgttgactctgccgcctttgtctaccattgtgttgcgggct
gattga

DBGET integrated database retrieval system