KEGG   Burkholderia sp. YI23: BYI23_B011500Help
Entry
BYI23_B011500     CDS       T01711                                 

Definition
glycoside hydrolase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
byi  Burkholderia sp. YI23
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:byi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1331839..1334052
Genome map
AA seq 737 aa AA seqDB search
MSAAASKKGDAHAARPVSSIEALAARAGFEIEWQDAHKIMQRVPETTLRILLDKLGLPCA
NATQIRQSMSAVDAEMSGRKLPPLITAEVDRGIALPVSAAKQGARYRIELESGEVIDGRF
TSPKGEIALLSPIAEPGYHTLVINDHRTTLAVAPARCFTIDDAWRSLSEDNADADTPPLW
GIAAQVYGLRRNGDGGIGDFTALATLATQTAKRGGHAVAISPMHAMFSAEPNKFSPYSPS
SRLFLNIAHVDPAAVLGAPAARAAIEKTGVAAELAELEGLTLIDWPRASKARLAVLRALF
EPFSQDRDSPFAKDFAAFVEEGGRPLEDHARFEALQAAQIAENGEGHWRNWPDALRDPRS
DAVTEFAAANRREVDFYLFTQWLAAKGLMHAQHAARDAGMAVGLVADLAVGCDSAGSHAW
SYRDEMLTGVSVGAPPDLFNQAGQSWGLTTFSPRAMRTQGFAAFIDMLRCAFKCAGGIRI
DHILGLRRLWLVPEGESAKDGAYLRYPLDDMLRLIALESWRHRAIVVGEDLGTVPPGFTE
RLQEHGLLGIRVLWFEREVDGPGFKPPREWDTGVTATTTTHDLPTVTGWWRGEDIVWRSK
IGQTMARADGRDAVEAALEERGEDREHLWRAFQDAGVAPDDVSAPDTGNAPVDEALAFVA
ATPAPLVTYPLEDLLALAEQPNLPGSIDEHPNWRRRLARPVDELFLDDAFADRLLAVDTA
RRRAGQPNEPTSNSETP
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgccgccagcaagaagggcgacgctcacgccgcgcggcccgtcagcagcatc
gaggcgctcgcggcgcgcgcgggcttcgagatcgaatggcaggacgcgcacaagatcatg
cagcgcgtgccggaaacgacgctgcgcattctgctcgacaagctcgggctgccgtgcgcc
aacgccacgcagatcaggcagagcatgtccgccgtcgatgccgaaatgagcggccgcaag
ctgccgccgctcatcaccgcggaagtggatcgcggcatcgcgctgccggtgtcggcggcg
aagcaaggcgcgcgctatcgcatcgaactcgaaagcggcgaagtgatcgacgggcgcttc
acgtcgccgaagggcgagatcgcgctgctctcgccgatcgcggagccgggctatcacacg
ctcgtcatcaacgaccatcgcacgacgctcgcggtcgcgcccgcgcgctgcttcaccatc
gacgatgcatggcgctccctgagcgaagacaacgccgatgccgacaccccgccgctctgg
ggcatcgcggcgcaggtctacggtctgcgtcgcaacggcgatggcggcatcggcgatttc
accgcgctcgcgacgctcgcgacgcagacggcgaagcgcggcgggcatgccgtcgccatc
agcccgatgcacgcgatgttcagcgccgagccgaacaagttcagcccgtattcgccgtcg
tcgcggctgtttttgaatatcgcgcatgtcgatcccgccgccgtgctcggcgcgccggca
gcacgcgcggcgatcgagaaaaccggggtcgccgccgaactcgccgaactcgaaggcctg
acgctgatcgactggccgcgtgcgtcgaaagcgcgtctcgcggtgctgcgcgcgctcttc
gaaccgttctcgcaagaccgcgattcgcccttcgcaaaggatttcgccgcgttcgtcgaa
gaaggcggacgtccgctcgaagaccacgcacgcttcgaggcgctgcaggccgcgcagatc
gcggaaaacggcgaaggccactggcgcaactggcccgacgccttgcgcgatccgcgcagc
gacgcggtcaccgaattcgccgccgcgaaccgccgcgaggtcgatttctatctcttcacg
caatggctcgcggccaagggtctcatgcacgcgcagcacgccgcgcgcgacgcgggcatg
gcggtcgggctcgtcgcggatctcgcggtcgggtgcgacagcgcgggcagtcatgcgtgg
tcgtatcgcgatgagatgctgacgggcgtgtccgtcggcgcgccgcccgatctcttcaat
caggccgggcaatcgtggggactcacgacgttctcgccgcgcgcgatgcgcacgcaaggc
ttcgcggccttcatcgacatgctgcgctgcgcgttcaagtgcgcgggcggcattcgcatc
gatcacatcctcggcttgcggcgtctgtggctcgtgccagaaggcgaaagcgcgaaagac
ggtgcgtatctgcgttatccgctcgacgacatgctgcggttgatcgcgctcgaatcgtgg
cggcatcgggcgatcgtggtcggcgaagatctcggcaccgtgccgccgggctttacggag
cgcttgcaggagcacggcttgctgggcattcgggtgctctggttcgaacgcgaagtggac
gggccgggtttcaagccgccgcgcgaatgggacaccggcgtcacggcgacgaccaccacg
cacgacctgccgaccgtcaccggatggtggcgcggcgaggacatcgtgtggcgctcgaag
atcggccagacgatggcgcgcgccgatggccgcgatgccgtggaggcggcgctggaagaa
cgcggcgaggatcgcgaacacttgtggcgcgcgttccaggacgcgggcgtggcgcccgac
gacgtgagtgcgcccgataccggcaacgcgcccgtcgatgaagcgctggccttcgtcgcc
gcaacgcccgcgccgctcgtcacgtatccgctcgaagacctgcttgcgcttgcggagcag
ccgaatctgcccggctcgatcgacgagcatccgaactggcgaaggcgcctggcccggccg
gtcgacgaactgttcctcgacgacgccttcgccgaccgcctgctcgccgtcgataccgcg
cgcaggcgcgccgggcaaccgaacgaacctacatcgaactccgaaacaccatga

DBGET integrated database retrieval system