KEGG   Burkholderia sp. YI23: BYI23_B011700Help
Entry
BYI23_B011700     CDS       T01711                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
byi  Burkholderia sp. YI23
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BYI23_B011700
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BYI23_B011700
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BYI23_B011700
Enzymes [BR:byi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BYI23_B011700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(1361934..1362770)
Genome map
AA seq 278 aa AA seqDB search
MDANEYEARILMSRIKNTFAALAAQGKKGLIPFITAGDPNPEQTVEFMHALAKGGADVIE
LGVPFSDPMADGPVIQRSSERALARGVTLKSVLADVARFRETDDKTPVVLMGYANPIERM
GAEAFAQAAKQAGVDGVLVVDYPPEEAEDFGAAMRAAGIDPIFLLAPTSTDERVAAVGKI
ASGYVYYVSLKGVTGAANLDVSSIASKIPAIKSHVPLPVGVGFGIRDAQTARAVADVADA
VVIGSRLVQLLEEAKPDAAAASLTSFIAEIRQALDAAQ
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atcgacgccaacgaatacgaagcgagaattctcatgtcccgtatcaagaatacttttgcg
gcgctggccgcgcagggcaaaaaagggctgatcccgttcatcacggcgggcgatccgaat
ccggaacagaccgtcgagttcatgcacgcgctggcgaagggcggcgcggacgtcatcgaa
ctgggcgtgccgttctccgacccgatggccgatggccccgtcatccagcgctcgtcggaa
cgcgcgctcgcgcgcggcgtgacgctcaagagcgtgctggccgatgtcgcgcgttttcgc
gaaaccgacgacaagacgcccgtcgtgctgatgggctacgcgaatccgatcgagcgcatg
ggcgccgaggccttcgcgcaagccgcgaagcaagcgggcgtcgatggcgtgctggtcgtc
gattatccgcccgaggaagccgaagacttcggcgccgcgatgcgcgctgccggcatcgat
ccgatcttcctgctcgccccgacttccaccgacgagcgcgtcgcggcggtcggcaagatc
gcgagcggctatgtctactacgtttcgctcaaaggcgtgaccggcgcggcaaatctggac
gtttccagcatcgcgagtaaaatcccggccatcaagtcgcatgtgcccctgccggtcggc
gtcggtttcggcattcgcgacgcgcaaaccgcacgcgccgtcgccgatgtcgcggacgcc
gtcgtcatcggcagccgcctcgtgcaactgctcgaagaggcgaagccggacgccgcagcc
gcgtcgctgacgagcttcatcgccgaaattcgtcaggcgctcgacgccgcacagtaa

DBGET integrated database retrieval system