KEGG   Burkholderia sp. YI23: BYI23_B011700Help
Entry
BYI23_B011700     CDS       T01711                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
byi  Burkholderia sp. YI23
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BYI23_B011700
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BYI23_B011700
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BYI23_B011700
Enzymes [BR:byi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BYI23_B011700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1361934..1362770)
Genome map
AA seq 278 aa AA seqDB search
MDANEYEARILMSRIKNTFAALAAQGKKGLIPFITAGDPNPEQTVEFMHALAKGGADVIE
LGVPFSDPMADGPVIQRSSERALARGVTLKSVLADVARFRETDDKTPVVLMGYANPIERM
GAEAFAQAAKQAGVDGVLVVDYPPEEAEDFGAAMRAAGIDPIFLLAPTSTDERVAAVGKI
ASGYVYYVSLKGVTGAANLDVSSIASKIPAIKSHVPLPVGVGFGIRDAQTARAVADVADA
VVIGSRLVQLLEEAKPDAAAASLTSFIAEIRQALDAAQ
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atcgacgccaacgaatacgaagcgagaattctcatgtcccgtatcaagaatacttttgcg
gcgctggccgcgcagggcaaaaaagggctgatcccgttcatcacggcgggcgatccgaat
ccggaacagaccgtcgagttcatgcacgcgctggcgaagggcggcgcggacgtcatcgaa
ctgggcgtgccgttctccgacccgatggccgatggccccgtcatccagcgctcgtcggaa
cgcgcgctcgcgcgcggcgtgacgctcaagagcgtgctggccgatgtcgcgcgttttcgc
gaaaccgacgacaagacgcccgtcgtgctgatgggctacgcgaatccgatcgagcgcatg
ggcgccgaggccttcgcgcaagccgcgaagcaagcgggcgtcgatggcgtgctggtcgtc
gattatccgcccgaggaagccgaagacttcggcgccgcgatgcgcgctgccggcatcgat
ccgatcttcctgctcgccccgacttccaccgacgagcgcgtcgcggcggtcggcaagatc
gcgagcggctatgtctactacgtttcgctcaaaggcgtgaccggcgcggcaaatctggac
gtttccagcatcgcgagtaaaatcccggccatcaagtcgcatgtgcccctgccggtcggc
gtcggtttcggcattcgcgacgcgcaaaccgcacgcgccgtcgccgatgtcgcggacgcc
gtcgtcatcggcagccgcctcgtgcaactgctcgaagaggcgaagccggacgccgcagcc
gcgtcgctgacgagcttcatcgccgaaattcgtcaggcgctcgacgccgcacagtaa

DBGET integrated database retrieval system