KEGG   Burkholderia sp. YI23: BYI23_B011720Help
Entry
BYI23_B011720     CDS       T01711                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00260  Glycine, serine and threonine metabolism
byi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
byi01130  Biosynthesis of antibiotics
byi01230  Biosynthesis of amino acids
Module
byi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BYI23_B011720
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BYI23_B011720
Enzymes [BR:byi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BYI23_B011720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AET91779
UniProt: G8MCG2
Position
2:complement(1363701..1364894)
Genome map
AA seq 397 aa AA seqDB search
MYNLPDERGHFGQYGGVFVSETLIHALDELRDAYDAAQKDPEFQKEYEYELKHYVGRPSP
IYHAKRWSEMLGGAQLYLKREDLNHTGAHKVNNVIGQALLARKMGKPRVIAETGAGQHGV
ATATIAARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVESGSKTLKDALNEAMRDW
VTNVENTFYIIGTVAGPHPYPMMVRDFQRVIGDECRVQMPEMAGRQPDAVIACVGGGSNA
MGIFYPYIDDKDVRLIGVEAAGDGIDTGRHAASLMGGSPGVLHGNRTYLLQDANGQIIET
HSVSAGLDYPGVGPEHAWLKDAGRAEYVGITDEEALKAFHDCCRIEGIIPALESSHALAY
GAKLAKTLPRDKVLLVNLSGRGDKDMHTVAERSGIQF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacttgccagacgaaagaggccacttcggccaatatgggggcgtgttcgtctcc
gaaacgctcatccacgcgctcgatgaattgcgcgacgcgtatgacgcggctcagaaagat
cccgagtttcaaaaagaatacgagtacgagctgaagcattatgtcggccgtccttcgccc
atttatcacgcgaagcgttggagcgaaatgctcggcggcgcgcagctttatctgaagcgc
gaagatctgaatcacacgggcgcgcacaaggtcaacaacgtgatcggccaggcgctgctc
gcccgcaagatgggcaagccgcgcgtgattgccgaaaccggcgcggggcagcatggcgtg
gcgaccgcgaccatcgcggcgcgcttcggcatggaatgcgtcgtctacatgggcgcggag
gacgtgcggcgtcaggcggcgaacgtctatcgcatgaaactgctgggcgcgacggtcgtg
ccggtcgaatccggctcgaagacgctcaaggatgccctcaacgaagccatgcgcgactgg
gtgacgaacgtggaaaacacgttctatatcatcggcacggtggcgggcccgcatccgtat
ccgatgatggtgcgtgacttccagcgcgtgatcggcgacgaatgtcgcgtgcagatgccc
gaaatggcgggtcgtcagccggacgcggtgattgcttgcgtaggcggcggatcgaatgcg
atgggcatcttttatccgtatatcgacgataaagacgtcaggttgatcggcgtggaagcg
gcgggcgacggtatcgatacgggccgccatgcggcatcgttgatgggcggaagccccggc
gtgctgcacggcaatcgtacgtatctgctgcaggacgcgaacggccagatcatcgagacg
cattcggtgtcggcgggtctggattatccgggcgtcggtcccgagcacgcgtggctgaag
gacgcgggacgcgcggagtacgtcggcatcacggacgaagaagcgctcaaggcgttccac
gactgctgccgcatcgagggcatcattccggcgctggagtcgagccacgcgctcgcgtac
ggggcgaagctcgcgaagacgctgccgcgcgacaaggtgctgctcgtcaatctgtcgggc
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatccagttctaa

DBGET integrated database retrieval system