KEGG   Burkholderia sp. YI23: BYI23_B012620Help
Entry
BYI23_B012620     CDS       T01711                                 

Definition
formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
byi  Burkholderia sp. YI23
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BYI23_B012620
  Energy metabolism
   00680 Methane metabolism
    BYI23_B012620
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BYI23_B012620
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BYI23_B012620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1467780..1468976)
Genome map
AA seq 398 aa AA seqDB search
MSSNRGVVYLGQGKVEVQSIDYPKMVDPRGRDIGHGVILRVVTTNICGSDQHMVRGRTTA
EVGLVLGHEITGEVIEIGRDVETLSIGDLVSVPFNVACGRCPTCKSQHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVMVPYADFNLLKFPDKAQAMSKIRDLTCLSDILPTGYHGAV
MAGVGPGSTVYIAGAGPVGMAAAASARLLGAACTIVGDMNEERLAHARAMGFETINLSKD
ATLGEQIEQLLGKPEVDCAVDCVGFEAHGHGSDSGHEAPATVLNSLMEITKAAGAIGIPG
LYVTDDPGAVDAAAKKGALSIRFGLGWAKSHSFHTGQTPVMKYNRNLMQAILWDRLPIAD
IVNVSVVSLDEAPEGYRKFDGGAPRKFVIDPHGLLKAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgcggcgtcgtttatctggggcagggcaaggtcgaagtgcaatccatc
gactatccgaaaatggtcgatccacgcgggcgcgacatcggccacggcgtcattctgagg
gtcgtcaccacgaacatctgcggctcggaccagcacatggtgcgcggccgcacgacggcg
gaagtcggcctcgtgctcggtcacgaaatcacgggcgaggtgatcgaaatcgggcgcgat
gtcgagacgctttccatcggcgatctcgtttcggtgccgttcaacgtcgcgtgcggccgt
tgtccgacgtgcaagtcgcagcacacgggcgtgtgcctgaacgtgaatccgtcgcgcgcg
ggcggtgcgtatggctatgtcgacatgggcggctggatcggcgggcaggccgaatacgtg
atggttccgtacgcggacttcaatctgctgaagtttcccgacaaggcgcaggcgatgtcg
aagattcgcgatctcacctgcctttccgacattcttccgacgggttatcacggcgcggtg
atggcgggcgtcggtccgggctcgaccgtgtatatcgcgggcgcggggccggtcgggatg
gcggctgcagcgtcggcgcgcttgctgggcgcggcgtgcacgatcgtcggcgacatgaac
gaggagcgtcttgcgcacgctcgtgcgatgggcttcgagaccatcaatctttcgaaggat
gcgacgctcggcgagcagatcgagcagcttctcggcaagccggaagtggattgcgcggtc
gattgcgtgggtttcgaggcgcacggccacggcagcgacagcggccacgaagcgcccgcc
acggtgctgaattcgctgatggaaatcacgaaggccgcaggcgcgatcggcattcccggc
ctttacgtgaccgacgatcccggcgccgtcgatgccgccgcgaagaagggcgccctgagc
attcgcttcggcctcggctgggcgaagtcgcattccttccacacgggccagacgcctgtc
atgaagtacaaccgcaatctgatgcaggcgattctgtgggaccgtttgccgattgcggat
atcgtgaacgtgtccgtcgtatcgctcgacgaagcgccggaaggctatcgcaagttcgat
ggcggcgcgccgcgcaagttcgtcatcgatccgcatggtctgctgaaagctgcttga

DBGET integrated database retrieval system