KEGG   Burkholderia sp. YI23: BYI23_B013920Help
Entry
BYI23_B013920     CDS       T01711                                 

Gene name
cheB
Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
byi  Burkholderia sp. YI23
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:byi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BYI23_B013920 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BYI23_B013920 (cheB)
Enzymes [BR:byi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BYI23_B013920 (cheB)
Two-component system [BR:byi02022]
 CheA family
  CheA-CheYBV
   BYI23_B013920 (cheB)
Bacterial motility proteins [BR:byi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BYI23_B013920 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1616646..1617233
Genome map
AA seq 195 aa AA seqDB search
MQHIGAVVIGASAGGVDALSHLLPALPKAFAPPVLIVVHVRQGQPSLLSALFATRCVLPI
EEPFDKDEIAHGTVYFAPAGYHMLVEAEGGEAPSIALSVDPPVRFSRPSVDVLFESAAHA
YGERLLGIVLSGANDDGARGARAIRDAGGACWAQDPTTAPSPAMPLAAIAEGAVHEVLTL
DAMTMRLSQCIRRQP
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatcggagcggtcgtgatcggcgcatcggcgggcggcgtcgatgcgttgagc
cacttgttgcccgcactgccgaaggcgttcgcgccgccggtgcttatcgtcgtgcatgtg
cggcagggccagccgagcctcttgtcggcactcttcgcgacgcgctgcgtcctgcccatc
gaagagccgttcgacaaggacgagatcgcgcacggcaccgtctatttcgcgccggcgggc
tatcacatgctcgtggaggcggaaggcggcgaggcgccgtcgatcgcgctttcggtcgat
ccgccggtgcgcttctcgcggccttcggtggacgtgctgttcgaatcggccgcgcatgcc
tacggcgagcggctgctcggcatcgtgctctcgggcgcgaacgacgacggcgcgcgcggc
gcgcgtgcgatccgcgatgcgggcggcgcatgctgggcgcaggacccgacgacggccccg
tcgcccgccatgccgctcgcggcgatcgcggagggcgcggtgcacgaagtactgacgctg
gacgcaatgacgatgcggctttcgcaatgcatccgccgccagccatga

DBGET integrated database retrieval system