KEGG   Burkholderia sp. YI23: BYI23_C002210Help
Entry
BYI23_C002210     CDS       T01711                                 

Definition
putative arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
byi  Burkholderia sp. YI23
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BYI23_C002210
Enzymes [BR:byi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BYI23_C002210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(268194..269147)
Genome map
AA seq 317 aa AA seqDB search
MQNYDDLHHCIGRSDRMSSATFMGVPMKTDAAKGASRACVLGVPFDCGTHPFRVGSREGP
DAIRRQSRLLRPFFVDPQGRVANPVEALRLVDAGNVDCHPGDVARSYPLIERAMDELLDA
GMTPVTMGGDGAVTLPQLRAVKKRHPDLVLLHIDAHTDTYDLDGFNTATTFTRACEEGLL
DTRSSFHVGARGTTFMDGVLGFGRALGYNVVPFSELEADREGCIARIRERIGARPVYLCF
DMDIFDPSCAPGVCTPEWGGLNPKEGIALLRAFAGMNFVSFDVNTVSPAQDVGEATAFLA
ATVMLECCALAAQSPSR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcagaactatgatgatcttcatcactgcatcggaaggagcgatcgaatgtcatccgcc
acattcatgggcgtgccgatgaaaaccgacgcggccaaaggcgcgtcgcgcgcatgcgtg
ctcggcgtgccgttcgactgcggcacgcatccgtttcgcgtgggatcgcgcgaaggtccg
gatgcgatccgccgccagtcgcgcctcttgcgtcccttcttcgtcgatccgcaagggcgc
gtcgcgaatccggttgaagcgctgcgcctcgtcgatgccggcaatgtcgactgtcatccc
ggcgatgtcgcgcgcagctatccgctgatcgagcgcgcgatggacgaactgctcgacgcg
ggcatgacgcccgtcacgatgggcggcgacggcgccgtgacgctgccgcaattgcgcgcg
gtgaagaagcgccatccggatctcgtgctgctgcatatcgacgcgcacaccgacacctac
gatctcgacggtttcaacacggccaccacgttcacgcgtgcctgcgaagagggcctgctc
gatacgcgcagcagctttcacgtgggcgcgcgcggcacgaccttcatggacggcgtgctc
ggtttcgggcgcgcgctcggctacaacgtcgtgcccttctccgaactcgaagccgaccgc
gaaggctgcatcgcgcgaatccgcgagcgcatcggcgcgcggccggtgtatctgtgcttc
gacatggacatcttcgatccgtcgtgcgcgccgggcgtctgcacgccggaatggggcgga
ctgaatccgaaggaaggcattgcgctgttgcgcgcgttcgcgggcatgaacttcgtctcc
ttcgacgtgaacacggtctcgcccgcgcaggacgtcggcgaagccaccgcgtttctcgcc
gcgaccgtcatgctcgaatgctgtgcgctcgccgcgcagtcgccttctcgttag

DBGET integrated database retrieval system