KEGG   Burkholderia sp. YI23: BYI23_C002660Help
Entry
BYI23_C002660     CDS       T01711                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
byi  Burkholderia sp. YI23
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BYI23_C002660
Enzymes [BR:byi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BYI23_C002660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:313367..314035
Genome map
AA seq 222 aa AA seqDB search
MSAMDEGALRRGIVDTALEMERLGINQGTSGNVSARLRDGLLITPSGTPARELDAADIVY
LPLDVRSDDDAILNGRPSSEWRIHRDLLRARPEMNAVVHTHSSAATALAIQGRAIPAVHY
MVAAAGGNSIRCAPYALFGTQALSDHALAALEGRRACLLAHHGVVALGVDLARAVWLAHE
VEVLARQYLLASQLGVPPVLTDEQMDEVLERFKTYGRRSKNE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgatggacgaaggcgcgctgcgtcgcgggatcgtcgatacggcgctcgagatg
gagcggctcgggatcaatcaaggcacgtcgggcaatgtaagcgcgcgcttgcgcgatggc
ctgctgatcacgccgagcggcacgcccgcccgcgagctggacgccgccgacatcgtgtac
ttgccgctcgacgtgcgcagcgacgacgacgcgatcctgaacggacggccttcatcggag
tggcgcatccatcgtgacctgctgcgcgcgcgtccggagatgaacgcggtcgtgcataca
cattcgagcgccgcgacggcgctcgccattcagggccgcgcgattcccgccgtgcattac
atggtcgcggccgcgggcggcaactcgattcgctgcgcgccgtatgcgctgttcggcacg
caggcgctatcggaccatgcgctcgccgcgctcgaaggacgccgcgcgtgtctgctcgcg
catcacggcgtcgtggcgctgggcgtggatcttgcgcgcgccgtgtggctcgcgcatgag
gtggaagtgctcgccaggcagtatctgctcgcgtcgcaactgggcgtgccgccggtgttg
acggacgagcagatggacgaagtgctggagcgattcaagacgtacggcaggcgcagcaag
aacgaatga

DBGET integrated database retrieval system