KEGG   Burkholderia sp. YI23: BYI23_C004090Help
Entry
BYI23_C004090     CDS       T01711                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
byi  Burkholderia sp. YI23
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BYI23_C004090
  Amino acid metabolism
   00300 Lysine biosynthesis
    BYI23_C004090
Enzymes [BR:byi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BYI23_C004090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(475788..477068)
Genome map
AA seq 426 aa AA seqDB search
MQADVLVTRSAEVSDQRRALARAVAASSQEVIDLARALVAEPSPYPPGDTHAVARRIEAM
LAGSGVEITRYGTLPHVMNLVVRVRGTRPGRRLVFNGHLDTFPLVDVDRWSADPNGEARD
GKLYGLGVSDMKGGIAAIVFALRHLAPLRDTLPGEVVATFVGDEESMGTEGAGYLLKHVP
EASGDAMISADTGSPAVLRFGEKGMIWLRLDASGKSAHAAHVHRGISAIERLLDAIQDLR
TLRDHPVDAPADVLAAIDNSGPASEELSGRGESDVLRRVTVTFGTVQGGRLSNLVADHAC
ATADIRLPVGVSVAQIEARINAILARHEGVSVEITRRYEPNWTSPDHEIVQRVRRNCAAR
LGIEPVVNMRVGASDARHYRMHGVPTVVCGLTAHNMGSFDEHVHVDELRALGEIYALTAF
DYLHGI
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccgacgttctcgtcacccgcagcgccgaagtatccgaccagcgacgcgccctt
gcgcgcgccgtcgccgcaagcagtcaggaagtcatcgatctggcgcgcgcgctggtcgcg
gagccaagcccgtatccgcccggcgacacgcacgccgtcgcacggcgcatcgaggccatg
ctggcgggcagcggcgtcgagatcacgcgatacggcaccctgccgcatgtgatgaacctc
gtcgtgcgggtgcgcggcacgcggcccgggcggcgcctcgtcttcaacggccatctcgat
accttcccgctcgtcgatgtggatcgctggagcgccgacccgaacggcgaggcccgcgac
ggcaagctctacggcctgggcgtctccgacatgaaaggcggcatcgcggcgatcgtgttc
gcgctgcgccaccttgccccactgcgcgacacgctgccgggcgaagtcgtcgcgaccttc
gtcggcgacgaagagagcatgggcaccgagggcgcgggctatctgctcaagcacgtgccc
gaagcctccggcgacgcgatgatcagcgccgacaccggctcgcccgccgtcctgcgcttc
ggcgagaaaggcatgatctggctgcggctggacgcgtccggcaagtcggcgcatgcggcc
cacgttcaccgcggcatcagcgcgatcgagcggctgctcgatgccattcaagacctcaga
acgctccgcgatcatcccgtcgatgcgcccgccgacgtgctcgccgcgatcgacaactca
ggccccgcatccgaagaactgtccggccgcggcgaaagcgacgtgctgcggcgcgtaaca
gtcaccttcggcacggttcagggcggccgcttatcgaatctcgtcgcggatcacgcgtgc
gccaccgccgatatccgtctgccggtcggcgtgagcgtcgcgcagatcgaggcgcgcatc
aacgcgatcctcgcgcggcacgaaggcgtcagtgtcgagatcacgcggcgctacgagccg
aactggacctcgcccgatcacgagatcgtccagcgcgtgcgccgcaattgcgcggcgcgg
ctcggcatcgagccggtcgtcaacatgcgtgtgggcgcatcggacgcgcggcactaccgc
atgcacggcgtgcccaccgtggtctgcggactcaccgcgcacaacatgggctcgttcgac
gagcacgtccacgtcgacgagctgcgcgcgctcggcgaaatctacgccctcaccgccttc
gactacctgcacggcatctga

DBGET integrated database retrieval system