KEGG   Burkholderia sp. YI23: BYI23_C004650Help
Entry
BYI23_C004650     CDS       T01711                                 

Definition
agmatinase
Orthology
K18459  
guanidinopropionase [EC:3.5.3.17]
Organism
byi  Burkholderia sp. YI23
Brite
Enzymes [BR:byi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.17  guanidinopropionase
     BYI23_C004650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:541730..542677
Genome map
AA seq 315 aa AA seqDB search
MATTDLSQMQLPRFAGIPTFMRVPFERDLAALDIALAGVPFDGGVTARPGARFGPREIRN
MSTMMRAIHHVTRFNPFEACRVADIGDVPFEHLYDLEAAHADIRRFFEPVFRAGKMALIA
GGDHSITYPVFQAIAPKQPLALVHIDAHTDTWDAFKGSKFTHGAPFRRAVEAGLLDPTRT
IQIGIRGAQNTDEGWRYSLDHGMRVVFIEEFEERGAAAIVEEARRVVGDAPVYLSLDVDG
LDPVFTPGTGTPEIGGLTTRETLALLRGLDGLNWVGGDVVEVSPPYDPSGNTALVAATMM
YEMLCLFAARQARSS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccgatctttcgcagatgcagttgccgcgcttcgcgggcattcccactttc
atgcgcgtgccgttcgagcgcgatctcgcggcgctcgatatcgcgctggcgggcgtgccc
ttcgacggcggcgtaaccgcgcgtccgggcgcgcgctttggcccgcgcgaaatccgcaat
atgtcgacgatgatgcgcgccatccatcacgtcacgcgcttcaatccgttcgaagcgtgc
cgcgtggccgatatcggcgatgtgcccttcgagcatctttacgatctcgaagccgcgcac
gccgatatccgccgctttttcgagcccgtgtttcgcgccgggaagatggcgctgatcgcg
ggcggcgatcactcgattacttatccggtcttccaggccatcgcgccgaagcaaccgctc
gcgctcgtgcatatcgatgcgcacaccgacacctgggacgcgttcaaaggctcgaagttc
acgcacggcgcaccgttcagacgcgcggtcgaagcgggtttgctcgatcccacgcgtacg
attcagatcggcatacgcggtgcgcagaatacggacgaaggctggcgttattcgctggat
cacggcatgcgcgtggtgttcatcgaagagttcgaggaacgcggggcggcggcgatcgtg
gaggaagcgcgacgggtggtgggcgatgcgcccgtctacctttcgctcgatgtcgatggg
ctcgatcccgtcttcacgcccggcaccggcacaccggaaatcggcggattgacgacgcgc
gaaacgcttgcgttgctgcgcggactcgacgggctaaactgggtcggcggtgatgtggtg
gaagtgtcgccgccatatgatccgagcggcaacaccgcccttgtcgccgcaacgatgatg
tacgagatgctgtgtctgttcgcggcacgtcaggcgcgatcgagttga

DBGET integrated database retrieval system