KEGG   Burkholderia sp. YI23: BYI23_C008060Help
Entry
BYI23_C008060     CDS       T01711                                 

Definition
Aldehyde Dehydrogenase
Orthology
K00135  
succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
byi  Burkholderia sp. YI23
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Tyrosine metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BYI23_C008060
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BYI23_C008060
   00310 Lysine degradation
    BYI23_C008060
   00350 Tyrosine metabolism
    BYI23_C008060
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     BYI23_C008060
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     BYI23_C008060
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     BYI23_C008060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:924957..926333
Genome map
AA seq 458 aa AA seqDB search
MIDVLNPADGTIVGQVEQHSEAQVRAAIDRTCAAFPAWSRTLARERSEVLRKWFDLVRAD
KTAFAELMCRENGKCLSEALGEIDYGLGFIEWYAEEAKRVYGDTIPTHAKDAAVIVTKEA
VGPVASITPWNFPFMMITRKVATALAAGCTILLKPAEETPLTAYKLLEYARRAGIPEGVF
EMVTGDPVQIGKLITGDPRIRKISFTGSTAVGKLLAAQCAGTLKKMTMELGGNAPFIVFE
DADLDAAASALVSAKLRNSGQVCISPNRVYVQASVHDAFVQRVKALVEAIPVDQGLQERF
VVGPLINRAAIDKVVELVDDSRQRGATVMLGGHPHAKGGLFYAPTILVDVADDMPIASTE
IFGPVFPVYRFSTEAEVIARSNATEYGLVAYAFTRDLGRAFRLSRDLEAGMVILNSGSVG
TASVPFGGVKQSGYGREGSHHGIEEYVHVKYTLMGGLA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgtactcaatcccgccgacgggaccatcgtcgggcaggtcgaacagcattcg
gaagcgcaggtgcgcgcggccatcgatcgcacgtgcgcggcctttccggcctggtcgcgc
acgctggcgcgcgaacgcagcgaagtgttgcgcaagtggttcgatctcgtccgtgccgac
aagaccgcattcgccgagctgatgtgccgcgagaacggcaagtgcttgtcggaagccctc
ggcgaaatcgactatggactcggcttcatcgaatggtatgcggaggaagccaagcgcgtg
tatggcgataccatccccacgcacgcgaaagacgcggcggtgatcgtcacgaaagaagcg
gtcgggccggtcgcgtcgatcacgccgtggaatttcccgttcatgatgatcacgcgcaag
gtggcgaccgccctcgcggcaggttgcacgatcctcctgaagccagccgaggaaaccccg
ctgaccgcctacaagctgctcgaatacgcgcgtcgcgcgggcataccggaaggcgtgttc
gagatggtgacgggcgaccccgtgcagatcggcaagctgatcaccggcgacccgcgcatc
cggaagatttcgttcaccggttccaccgccgtgggcaagctgctcgccgcgcagtgcgcc
ggcacgctcaagaagatgacgatggaactgggcggcaacgcgccgttcatcgtcttcgaa
gacgccgatctcgatgcagccgcgagcgcactcgtgtccgcgaagctgcgcaacagcggg
caagtctgcatttcgccgaaccgcgtgtatgtgcaggcaagcgtgcacgacgcattcgtt
cagcgcgtcaaggcgctcgtcgaggccattccggtcgatcaagggctgcaggaacgcttc
gtggtcggtccgctgatcaaccgcgcggccatcgacaaggtcgttgaactcgtcgacgat
tcgcgccagcgcggcgccacggtcatgctcggcggacatccgcacgcgaaaggcggactc
ttctacgcgcccacgattctcgtcgatgtcgcggacgatatgccgatcgcctccaccgaa
atcttcggtcccgtcttcccggtctatcgcttctccacggaagccgaagtcatcgcgcgc
agcaacgccaccgaatatggcctcgtcgcctatgcgttcacgcgcgatctgggccgcgcg
ttccgcctttcgcgcgatctcgaagccggcatggtgattctgaactccggctcggtcggc
acggcttcggtgccgttcggcggcgtgaagcagtccggatacggacgcgaaggcagtcat
catgggatcgaggaatatgtgcacgtgaagtacacgttgatgggcggtctcgcctga

DBGET integrated database retrieval system