KEGG   Burkholderia sp. YI23: BYI23_C008060Help
Entry
BYI23_C008060     CDS       T01711                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00135  
succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
byi  Burkholderia sp. YI23
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Tyrosine metabolism
Butanoate metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BYI23_C008060
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BYI23_C008060
   00310 Lysine degradation
    BYI23_C008060
   00350 Tyrosine metabolism
    BYI23_C008060
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BYI23_C008060
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     BYI23_C008060
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     BYI23_C008060
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     BYI23_C008060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3:924957..926333
Genome map
AA seq 458 aa AA seqDB search
MIDVLNPADGTIVGQVEQHSEAQVRAAIDRTCAAFPAWSRTLARERSEVLRKWFDLVRAD
KTAFAELMCRENGKCLSEALGEIDYGLGFIEWYAEEAKRVYGDTIPTHAKDAAVIVTKEA
VGPVASITPWNFPFMMITRKVATALAAGCTILLKPAEETPLTAYKLLEYARRAGIPEGVF
EMVTGDPVQIGKLITGDPRIRKISFTGSTAVGKLLAAQCAGTLKKMTMELGGNAPFIVFE
DADLDAAASALVSAKLRNSGQVCISPNRVYVQASVHDAFVQRVKALVEAIPVDQGLQERF
VVGPLINRAAIDKVVELVDDSRQRGATVMLGGHPHAKGGLFYAPTILVDVADDMPIASTE
IFGPVFPVYRFSTEAEVIARSNATEYGLVAYAFTRDLGRAFRLSRDLEAGMVILNSGSVG
TASVPFGGVKQSGYGREGSHHGIEEYVHVKYTLMGGLA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgtactcaatcccgccgacgggaccatcgtcgggcaggtcgaacagcattcg
gaagcgcaggtgcgcgcggccatcgatcgcacgtgcgcggcctttccggcctggtcgcgc
acgctggcgcgcgaacgcagcgaagtgttgcgcaagtggttcgatctcgtccgtgccgac
aagaccgcattcgccgagctgatgtgccgcgagaacggcaagtgcttgtcggaagccctc
ggcgaaatcgactatggactcggcttcatcgaatggtatgcggaggaagccaagcgcgtg
tatggcgataccatccccacgcacgcgaaagacgcggcggtgatcgtcacgaaagaagcg
gtcgggccggtcgcgtcgatcacgccgtggaatttcccgttcatgatgatcacgcgcaag
gtggcgaccgccctcgcggcaggttgcacgatcctcctgaagccagccgaggaaaccccg
ctgaccgcctacaagctgctcgaatacgcgcgtcgcgcgggcataccggaaggcgtgttc
gagatggtgacgggcgaccccgtgcagatcggcaagctgatcaccggcgacccgcgcatc
cggaagatttcgttcaccggttccaccgccgtgggcaagctgctcgccgcgcagtgcgcc
ggcacgctcaagaagatgacgatggaactgggcggcaacgcgccgttcatcgtcttcgaa
gacgccgatctcgatgcagccgcgagcgcactcgtgtccgcgaagctgcgcaacagcggg
caagtctgcatttcgccgaaccgcgtgtatgtgcaggcaagcgtgcacgacgcattcgtt
cagcgcgtcaaggcgctcgtcgaggccattccggtcgatcaagggctgcaggaacgcttc
gtggtcggtccgctgatcaaccgcgcggccatcgacaaggtcgttgaactcgtcgacgat
tcgcgccagcgcggcgccacggtcatgctcggcggacatccgcacgcgaaaggcggactc
ttctacgcgcccacgattctcgtcgatgtcgcggacgatatgccgatcgcctccaccgaa
atcttcggtcccgtcttcccggtctatcgcttctccacggaagccgaagtcatcgcgcgc
agcaacgccaccgaatatggcctcgtcgcctatgcgttcacgcgcgatctgggccgcgcg
ttccgcctttcgcgcgatctcgaagccggcatggtgattctgaactccggctcggtcggc
acggcttcggtgccgttcggcggcgtgaagcagtccggatacggacgcgaaggcagtcat
catgggatcgaggaatatgtgcacgtgaagtacacgttgatgggcggtctcgcctga

DBGET integrated database retrieval system