KEGG   Burkholderia sp. YI23: BYI23_C008060Help
Entry
BYI23_C008060     CDS       T01711                                 

Definition
Aldehyde Dehydrogenase
Orthology
K00135  
succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
byi  Burkholderia sp. YI23
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Tyrosine metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:byi00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:byi00250]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:byi00310]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:byi00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:924957..926333
Genome map
AA seq 458 aa AA seqDB search
MIDVLNPADGTIVGQVEQHSEAQVRAAIDRTCAAFPAWSRTLARERSEVLRKWFDLVRAD
KTAFAELMCRENGKCLSEALGEIDYGLGFIEWYAEEAKRVYGDTIPTHAKDAAVIVTKEA
VGPVASITPWNFPFMMITRKVATALAAGCTILLKPAEETPLTAYKLLEYARRAGIPEGVF
EMVTGDPVQIGKLITGDPRIRKISFTGSTAVGKLLAAQCAGTLKKMTMELGGNAPFIVFE
DADLDAAASALVSAKLRNSGQVCISPNRVYVQASVHDAFVQRVKALVEAIPVDQGLQERF
VVGPLINRAAIDKVVELVDDSRQRGATVMLGGHPHAKGGLFYAPTILVDVADDMPIASTE
IFGPVFPVYRFSTEAEVIARSNATEYGLVAYAFTRDLGRAFRLSRDLEAGMVILNSGSVG
TASVPFGGVKQSGYGREGSHHGIEEYVHVKYTLMGGLA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgtactcaatcccgccgacgggaccatcgtcgggcaggtcgaacagcattcg
gaagcgcaggtgcgcgcggccatcgatcgcacgtgcgcggcctttccggcctggtcgcgc
acgctggcgcgcgaacgcagcgaagtgttgcgcaagtggttcgatctcgtccgtgccgac
aagaccgcattcgccgagctgatgtgccgcgagaacggcaagtgcttgtcggaagccctc
ggcgaaatcgactatggactcggcttcatcgaatggtatgcggaggaagccaagcgcgtg
tatggcgataccatccccacgcacgcgaaagacgcggcggtgatcgtcacgaaagaagcg
gtcgggccggtcgcgtcgatcacgccgtggaatttcccgttcatgatgatcacgcgcaag
gtggcgaccgccctcgcggcaggttgcacgatcctcctgaagccagccgaggaaaccccg
ctgaccgcctacaagctgctcgaatacgcgcgtcgcgcgggcataccggaaggcgtgttc
gagatggtgacgggcgaccccgtgcagatcggcaagctgatcaccggcgacccgcgcatc
cggaagatttcgttcaccggttccaccgccgtgggcaagctgctcgccgcgcagtgcgcc
ggcacgctcaagaagatgacgatggaactgggcggcaacgcgccgttcatcgtcttcgaa
gacgccgatctcgatgcagccgcgagcgcactcgtgtccgcgaagctgcgcaacagcggg
caagtctgcatttcgccgaaccgcgtgtatgtgcaggcaagcgtgcacgacgcattcgtt
cagcgcgtcaaggcgctcgtcgaggccattccggtcgatcaagggctgcaggaacgcttc
gtggtcggtccgctgatcaaccgcgcggccatcgacaaggtcgttgaactcgtcgacgat
tcgcgccagcgcggcgccacggtcatgctcggcggacatccgcacgcgaaaggcggactc
ttctacgcgcccacgattctcgtcgatgtcgcggacgatatgccgatcgcctccaccgaa
atcttcggtcccgtcttcccggtctatcgcttctccacggaagccgaagtcatcgcgcgc
agcaacgccaccgaatatggcctcgtcgcctatgcgttcacgcgcgatctgggccgcgcg
ttccgcctttcgcgcgatctcgaagccggcatggtgattctgaactccggctcggtcggc
acggcttcggtgccgttcggcggcgtgaagcagtccggatacggacgcgaaggcagtcat
catgggatcgaggaatatgtgcacgtgaagtacacgttgatgggcggtctcgcctga

DBGET integrated database retrieval system