KEGG   Burkholderia sp. YI23: BYI23_C010060Help
Entry
BYI23_C010060     CDS       T01711                                 

Definition
PAS/PAC sensor hybrid histidine kinase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
byi  Burkholderia sp. YI23
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:byi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BYI23_C010060
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BYI23_C010060
Enzymes [BR:byi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     BYI23_C010060
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BYI23_C010060
Two-component system [BR:byi02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   BYI23_C010060
Bacterial motility proteins [BR:byi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BYI23_C010060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1175023..1179189)
Genome map
AA seq 1388 aa AA seqDB search
MTSSRSKALPSENFEPLPFAVVGMGASAGGIEALLNFFENAPSDMDMAFVVIVHLPADHM
SRADEVLQRVTDMPVKQVSSTSAIEKNHIYINAPGKHLEMSQGQLEALDRAGATGSTTTI
DHFFATLATAHGPRSIGIVVSGSGSDGAAGLLRIKEMGGITVAQKPEDAHFAEMPQHAIT
TRQVDFILPAAEMPEKLLDLWNNAKNIHLPISEGNEAAEKDLAPAAGGAERALSDVLMQL
RVRTGHDFRHYKRATVLRRIERRMQVNGLRDIGAYRDYLRANPDETTSLLADMLIGVTQF
FRDREAFDALRRDVVPTLLDATKGEAQLRVWVPGCSTGEEAYSLAILLAQAREAAGFETT
YQIFATDIDEPAIAQARAGSYLGSISADVPGDLLRRYFKQEGGRYQIVKSVRERILFAAH
SLLRDPPFSHLDLISCRNVLIYLDRAVQRQVLELFHFALRAGGYLFLGTAESADTADDLF
TIVDKKSRLYRARTVLNRVKPPVAFPSLGPATLAQREDVVSAAVQASIASGPETPERRNF
SFAALHQRVLEEYAPPSVVVNRDSEIVHLSSTAGRFLRHGGGEPSSNIMALVLPELRLDL
RTTLFRAHQTGGSVEARRVKLNQDGRAVWVNMTVRPFHDAGVSADFFLVLFDEVQEHMAD
EGLPEGKGQDPLLVQLERELQHTREQLATTIEQHETTVEELKASNEELQAINEELRSATE
ELESSKEELQSVNEELTTVNAELQARVEDTAKANDDLQNIIASTEIATVFVDKQIRVKRF
TTSATRVFKLIDVDIGRSLFDITHSLLYSSLADDVKQAFETLKLIDREVESSDGRWYLMR
LLPYRTADDASTARCSRSSTSRRGTRPRNRRASASSVCGSSRNRPTTTRSSVQDPAGVIV
TWNAGAERIFGFSEKEVVGKNIALIYPPEDRAAKVPALEREIAAREGRADDERWHVTRDE
RRVYCSGVVTPISDPSFTGFAKIARDLTERKLREDANREALAHEHAEREKETLSNQLKDD
FIAMLSHELKHPLNLIGMKAEILPRLPETRGIGAVRETADSIRRAVRGQAQIIDDLLDLS
RVRTGKLALSIVPVDVAAVLARIVDVSETEAAQREIRLRASNLGEPIYAFADAVRCEQIL
WNLVSNALKFTDRGGSVDLKIARDGGMVRIDIADTGQGIEASALPHIFDMYRQSARNRTS
GGLGIGLALAKQLVEMHGGRIEARSEGLGRGATLSVWLPAAATRETMPAARAGRTRPVAG
ARILLVDNDSEATASFAALLGLEQAAVQIASSGEQALDLLSKNPVDALISDIQLPGIDGY
ELIGRVRATPLLAGMKAIAVTAFGRDEDKRAARHAGFDAHLNKPVDFPELLHTLDLLLGP
DRHEEESA
NT seq 4167 nt NT seq  +upstreamnt  +downstreamnt
atgactagcagccgctcgaaggcgctgccttccgaaaatttcgagcccttgccgttcgcc
gtggtcggcatgggcgcgtcggcgggcggcatcgaagccttgctcaatttcttcgagaac
gcgccgtccgacatggacatggcgttcgtcgtgatcgtccatttgccggcggatcacatg
agccgcgcggacgaagtgctgcagcgcgtaacggacatgcccgtcaagcaggtttccagc
acgtccgcgatcgagaagaaccacatctatatcaatgcgccgggcaagcatctggagatg
tcgcaggggcagctcgaagcgctggaccgtgcgggcgcgaccggctcgaccacgacgatc
gatcacttcttcgccacgctcgcgaccgcgcacggcccgcgctcgatcggcatcgtggtg
tcgggttcggggtcggacggcgcggcgggtctgctgcgcatcaaggagatgggcggcatc
acggtcgcgcagaagcccgaagacgcgcatttcgccgaaatgccgcaacacgcgatcacc
acgcgccaggtcgatttcattctgcccgcggcggaaatgccggaaaagctgctcgacctc
tggaacaacgcgaagaacatccatctgccgatttccgaaggcaacgaggccgccgagaaa
gatctcgcgcccgcggcgggcggcgccgagcgcgcgctctccgacgtgctcatgcaattg
cgcgtgcgtaccggccacgacttccgccactacaagcgcgcaaccgtgctgcggcgcatc
gagcggcgcatgcaggtgaacgggctgcgcgacatcggcgcgtaccgcgactatctgcgc
gcgaatcccgacgaaaccacctcgctgctcgccgacatgctgatcggcgtgacgcagttt
ttccgcgatcgcgaggcgttcgacgcgctgcggcgcgatgtcgtgcccaccttgctcgat
gcaacgaaaggcgaagcgcaactgcgcgtctgggtgcccggctgctccaccggcgaggaa
gcctattcgcttgcgatcctgcttgcgcaggcgcgcgaagccgcgggattcgagacgacc
tatcagattttcgcgaccgatatcgacgagccggccattgcgcaggcgcgcgccggttcc
tatctcggttcgatctcggccgacgtgcccggcgatctcctgcgccgctatttcaagcag
gaaggcggccgctatcagatcgtcaaatcggtgcgcgagcgtattttgtttgccgcgcac
agcctgctgcgcgatccgccgttctcgcatctggacctgatctcgtgccgcaacgtgctg
atctatctcgatcgcgccgtgcagcggcaagtgctcgaactcttccatttcgcattgcgc
gcgggcggctatctcttcctcggcacggccgaatccgccgatacggccgacgacctcttc
accatcgtcgataagaaaagccgcctctaccgggcgcgcacggtgctgaaccgcgtgaag
ccgccggtcgcgtttccgtcgctcgggcccgcgaccctggcgcagcgcgaggatgttgtt
tcggcggcggtgcaggcgagtatcgcgagcgggccggagacgccggagcggcgcaatttc
tcgttcgcggcgctgcatcagcgcgtgctcgaggaatatgcgccgccgagcgtggtcgtg
aaccgcgattcggagatcgttcatctttcctcgacggcgggccgtttcctgcgccacggc
ggcggcgaaccgtcctcgaacatcatggcgctcgtgctgccggagctgcggctcgatctg
cgcacgacgctctttcgcgcgcatcagacgggcggcagcgtcgaggcgcggcgtgtcaag
ctcaatcaggacggccgcgccgtgtgggtcaacatgacggtgcgccccttccacgatgcg
ggcgtgagcgcggattttttcctggttctgttcgacgaagtgcaagagcatatggccgat
gaaggactgcccgaaggcaaggggcaggacccccttctggtgcaactcgaacgcgaattg
cagcatacccgcgagcaactcgcgacgaccatcgagcagcacgagacgacggtcgaggag
ctgaaggcgtccaacgaagaattgcaggcgatcaacgaagaactgcgctccgccaccgaa
gagctcgaaagcagcaaggaagaactgcagtcggtcaacgaggagctgaccacggtcaac
gccgaactgcaggcgcgcgtcgaagacaccgccaaggcgaacgacgacctgcagaacatc
atcgcgtcgacggaaatcgccaccgtgttcgtcgacaagcagattcgcgtcaagcgcttc
accacgagcgcgacgcgcgtgttcaagctgatcgatgtcgatatcggccgctcgctgttc
gacatcacgcattcgctgctgtattcctcgctcgcggacgacgtgaagcaggcgttcgag
acgctcaagctgatcgaccgcgaagtcgaaagctccgacggccggtggtatctcatgcgc
ctcctgccgtaccgcacggcggacgacgcatcgacggcgcggtgctcacgctcatcgaca
tcacggcgcggcacaaggccgaggaatcggcgcgcatcggcgagcagcgtctgcggctcg
tcgcgcaatcgaccaacgactacgcgatcatccgtgcaggacccggccggcgtgatcgtc
acatggaacgcgggcgcggagcgcattttcggtttctccgagaaggaagtggtcggcaag
aacatcgcgctgatctatccgccggaagaccgcgccgcgaaggtgcccgcgctggagcgc
gagatcgccgcgcgcgagggacgcgccgacgacgaacgctggcacgtcacgcgcgacgag
cgccgcgtgtattgcagcggcgtggtcacgccgatctcggacccgtcgtttacgggcttc
gcgaagatcgcgcgcgatctgaccgaacgcaagctgcgcgaggatgcgaaccgcgaggcg
ctcgcacacgagcacgccgagcgcgagaaggaaacgctgtcgaaccagctcaaggacgac
ttcatcgcgatgctgtcgcacgagctcaagcatccgctgaatctgatcggcatgaaggcg
gagatcctgccgcgcctgccggaaacgcgtggcatcggcgcggtgcgcgaaaccgccgat
tcgatccgccgcgcggtgcgtgggcaggcgcagatcatcgacgacctgctcgatctttcg
cgcgtgcgcaccggcaagctcgcgctcagcatcgttccggtggatgtcgcagcggtgctc
gcgcgcattgtcgatgtgagcgagaccgaagcggcgcaacgcgaaatccgcctgcgcgcg
agcaatctcggcgaacccatctacgcgttcgccgatgccgttcgctgcgagcagattctc
tggaatctcgtgtcgaacgcgctcaagttcacggatcgcggcggctcggtcgatctgaag
atcgcgcgcgacggcggcatggtgcgcatcgatatcgccgatacggggcagggcatcgaa
gcgtccgcgctgccgcatatcttcgacatgtaccggcaaagcgcgcgcaatcgcacttcg
ggaggactcggcatcgggcttgcgctcgcgaagcagctcgtggagatgcacggcgggcgt
atcgaggcgcgctcggaaggcctcgggcgcggcgcgacgctgtcggtctggctgcccgcg
gcggccacgcgcgaaaccatgcccgcggcgcgtgcaggacgcacgcggcccgtcgcgggc
gcgcgcattctgctcgtcgacaacgactccgaggcgaccgcttccttcgccgcgctgctc
gggctggaacaggcggcggtgcagatcgcatcgagcggggaacaggcgctcgacctgctt
tcgaagaatccggtcgatgcgttgatctcggacattcagttgcccggcatcgacggatac
gagctcatcgggcgcgtgcgcgccacgcctttgctcgcgggcatgaaggcgatcgcggtg
acggcattcggcagggacgaagacaagcgcgcggcccggcatgcgggcttcgacgcgcat
ctgaacaaaccggtggatttcccggaactgctacatacgctcgatttgctgctcggtccg
gaccggcacgaagaagaaagcgcgtaa

DBGET integrated database retrieval system