KEGG   Burkholderia sp. YI23: BYI23_C012200Help
Entry
BYI23_C012200     CDS       T01711                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BYI23_C012200
Enzymes [BR:byi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BYI23_C012200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase Nitro_FeMo-Co Aldolase DUF5354
Motif
Other DBs
NCBI-ProteinID: AET93366
UniProt: G8MIE9
Position
3:1421651..1422583
Genome map
AA seq 310 aa AA seqDB search
MKSVVILGIYVTDLAFRAARMPLLGETVPGSAFKMGPGGKGSNQAVAAARAGADVIFCTR
IGADAFGDIAQATWAAEGITSRATVMDDVATGAAHIYVDENTGGNAIIVAAGAAGALVPE
DVDAIEEDIARAGVFVTQLEQPIPAARRGLELARRHGVTTVFNPAPAMPLTDEIYPLCDY
ITPNETEAQALTGIEIKSVDDARRAANVLLDKGVRAVIVTLGEAGALLHTANESTLVPAF
DCGRVVETAGAGDGFTGGFAAALARGESPLDAVRFGCALASLSVTRPGTAPSMPRLHEIN
AVLEQRSVTQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgtcgtcattctcggcatctacgtgacggacctcgcgtttcgcgcggcgcgc
atgccgctgctcggcgaaacggtgccgggctccgcgttcaagatgggaccgggcggcaag
ggctcgaaccaggccgtggccgccgcgcgcgcgggcgcggacgtgatcttctgcacgcgc
atcggcgccgacgcattcggcgacatcgcgcaggcgacatgggccgccgaaggcatcacc
tcgcgcgcgaccgtgatggacgatgtcgccacgggcgccgcgcatatctacgtcgatgaa
aacacgggcggcaatgcgatcatcgtcgcggcgggggcggcgggcgcgctcgtgcccgaa
gacgtcgatgcgatcgaagaggacatcgcgcgcgcgggcgtcttcgtcacgcaactggag
cagccgattccggccgcgcggcgcgggctcgaactcgcgcgcaggcatggcgtgacaacg
gtgttcaatcccgcgcccgccatgccgctcaccgacgagatctatccgctgtgcgactac
atcacgccgaacgaaacggaagcgcaggcgctcaccggcatcgagatcaagtcggtcgat
gacgcgcgccgcgccgcgaacgtgctgctcgacaagggcgtgcgcgcggtcatcgtcacg
ctgggcgaggcgggcgcgctgctgcacacggcgaacgaatcgacgctcgtgcccgcgttc
gactgcggccgcgtcgtggaaacggccggcgcgggcgacggcttcaccggcggcttcgcg
gccgcgctcgcacgcggcgaaagcccgctcgatgcggtgcgcttcggctgcgcgctcgcg
agcctttcggtcacgcggccgggcaccgcgccttcgatgccgcgtcttcacgagatcaac
gcggtgctcgaacaacggagcgtcacgcaatga

DBGET integrated database retrieval system