KEGG   Burkholderia sp. YI23: BYI23_D000420Help
Entry
BYI23_D000420     CDS       T01711                                 

Definition
putative cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
byi  Burkholderia sp. YI23
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
byi_1p:53241..54707
Genome map
AA seq 488 aa AA seqDB search
MRKLFLAALCCTTLMLAACGGSSSDNGTSAASGASAPTQASAPAASTLSAKAQLGEKIFF
DKGLSGNKNMACASCHDPAFAYGPPNSLSVQLGSDPAQAGVRAVPSLRYKSMTPPYDDNA
DNPDGVTQNAPGGGFMWDGRATSLATQPALPLLNPIEMNNSSPDAVVKAVRSASYAALFQ
QVYGQAVFGDTTTTFNDIGDALQQYQIEDPSFAPYSSKFDLYLGNKIGGTLTAAELHGLQ
LFNDTTNGAGCAACHFVGANFHGSVGLMTDFTYQAIGAPRNDASIPNNPDPIPANANASF
IDMGLCGPYATLHVPGTATSGAGPDPLTGVNVPDPYCGRFKVPTLRNVASRNAFFHNGVF
HSLVQVVNFYNTRDTNPEFWYPSTGGSGAVVNNPGFALQPTYTPGAKINRFNDLPAAYQG
NIDEELPMGQGQTDAGGATAADGAKARPFHGATQLTQKDVSDLICFLKTLSDGYQQPAQA
ASSGDCVN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagctatttctcgctgcactctgttgcactactctcatgctcgccgcctgcggg
ggcagttcgtccgacaacgggacatcggcggcgtccggcgcttcggccccgacgcaggca
agcgccccggcggcatcgacgttgagcgcgaaagcgcagctcggcgagaagatctttttc
gacaagggcctgtcgggcaacaagaacatggcgtgcgccagttgccacgacccggccttt
gcctacggtccgccgaacagcctgtccgtgcagcttggctccgatcccgcgcaggcgggc
gtgcgcgcggtgccgtcgctgcgctacaagtcgatgacgccgccctacgacgacaatgcc
gacaaccccgatggcgtgacgcagaacgcgcccggcggcggtttcatgtgggacggccgg
gcgacctcgctcgcgacgcagcctgcgctgccgctcctgaatccgatcgagatgaacaac
agctcgccggatgcggtcgtcaaggccgtgcgcagtgcgtcgtacgccgcgctgttccag
caggtctacggccaggcggtgttcggcgacacgacgaccaccttcaacgatatcggcgac
gcgctccagcagtatcagatcgaggacccgtcgttcgcgccgtattcgagcaagttcgac
ctctacctcggcaacaagatcggcggcacgctgacagccgccgagctgcacggtctccag
ctattcaacgacacgaccaacggcgccgggtgcgcggcctgtcacttcgtgggcgcgaac
tttcacggctcggtcggcctgatgaccgacttcacatatcaggcgatcggtgcgccgcgc
aacgatgcgtcgattccgaacaacccggatccgattcccgccaacgcgaacgcatcgttc
atcgacatggggctgtgcggaccctacgcgacgctccatgttcccggcacggccacgagc
ggcgcgggaccggatccgctcacgggtgtgaacgtgccggacccgtactgcgggcgcttc
aaggtgccgacgctgcgcaacgtggcgtcgcgcaacgcgttctttcataacggcgtgttc
cattcgctggtgcaggtcgtgaacttctacaacacgcgtgatacgaacccggagttttgg
tatccgtcgacgggaggcagcggcgcggtcgtcaacaatccgggtttcgcgcttcagccg
acctatacgccgggcgcgaagatcaaccggttcaacgacctgcccgcggcgtatcaaggc
aacatcgatgaagaattgccgatgggacagggccagaccgatgccggcggcgccaccgcg
gcggacggtgcgaaagcgcggccctttcacggcgcgacccagctcacgcagaaggacgtg
tccgacctgatctgctttctcaagacgctcagcgacggctatcagcagccggcgcaggca
gcgagttccggcgattgcgtgaactga

DBGET integrated database retrieval system