KEGG   Burkholderia sp. YI23: BYI23_D005770Help
Entry
BYI23_D005770     CDS       T01711                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
byi  Burkholderia sp. YI23
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:byi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:byi00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:byi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:byi00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:byi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
byi_1p:669281..671236
Genome map
AA seq 651 aa AA seqDB search
MESGHASGHIWQPGERELQNAGIVTLMRALDVRSYDELMRVSIAEPERYWQTVMRECAIA
WDVPPTGYADLSRGPQFPSWFPGGRLNWVNTIYAWARRPATAQQKAVVAEREDGSVSALT
YAELEQRVRDFAAGLARHGVKEGDRIGLLMENGVEATISLLAIVHLGALVVPLFSGFGVD
AIVARLSAAEARFVIASTGFARRTKRVNVEGALRDAWRQLPLLEHVVWKRAEGETAQDER
DLDWQETSVAAQGRGTDAVTVTPDTAFMVIYTSGTTGKPKGVVHTHGSFPIKVAHDSLVH
FDVHPGDVYCWPADMGWIAGTLVLGCALLRGATLVCYDGAPDYPDWSRMSRVVERHRITH
FGSAPTLIRGMASHEALALAGDRSTVRLLITAGEGIAPEHFNWFLQRFGDGTAPVINYTG
GTEASGALLASVPIRPIPPSGFNTVSPGVAADVVNAEGESVTGVVGELAMRAPFVGMTHS
FWRDDERYLETYWQTIPGIWVHGDLALRTPEGNYFMMGRSDDTLKVAGKRLGPAEVEEVV
LELADVSEAAAIGVADADKGQKLVVFVVPKPDASVVAAELTSIVSAHVDKRLGRPFRPGC
VHVVAQLPKTRSSKIMRRVIRSVYCGLPPGDLSSLDNPAALDEVRSAASSG
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
ctggaatctggtcacgcgtccggtcacatctggcagccgggcgagcgcgaactgcagaac
gccggcatcgtcacgctgatgcgcgcgctcgacgtgcgttcgtatgacgaactgatgcgc
gtgtcgatcgcggagcccgagcgctactggcagaccgtgatgcgcgaatgcgcgatcgcg
tgggatgtgccgcccaccggctacgcggacctctcgcgcggcccgcagtttccgagctgg
ttccccggcggccggctcaactgggtcaacacgatctacgcgtgggcgcgccgtcctgcc
acggcgcagcaaaaggcggtggtggccgaacgcgaggacggcagcgtgagcgcgctgacc
tatgcggaactggagcagcgcgtgcgcgatttcgcggcgggcctcgcgcggcatggcgtc
aaagaaggcgaccgtatcggcctgctgatggaaaacggcgtcgaggcgaccatctcgctt
ctggccatcgtgcatctcggcgcgctggtcgtgccgctcttcagcggcttcggcgtcgat
gcgatcgtcgcgcgcctctcggccgccgaggcgcgtttcgtgatcgcgtccacgggattc
gcgcgccgcaccaagcgcgtgaacgtcgaaggcgcgctgcgcgacgcatggcgccagttg
ccgctcctcgaacatgtggtctggaagcgcgccgaaggcgaaaccgcgcaggacgaacgc
gacctggactggcaggaaacctcggtcgccgcgcagggccgaggcacggacgccgtcacc
gtcacgcccgacacggccttcatggtgatctacacgtccggcaccacgggcaagcccaaa
ggcgtggtgcacacgcacggcagtttcccgatcaaagtcgcgcacgactcgctggttcat
ttcgacgtgcatcccggcgatgtctactgctggcccgccgatatgggctggatcgcgggc
acgctggtgctcggctgcgcgctgctgcgcggcgcgacgctcgtgtgctacgacggcgcg
cccgattatcccgactggtcgcgcatgtcgcgcgtggtcgaacggcaccggatcacgcac
ttcggttcggcgcccacgctgattcgcgggatggcgagccacgaagcgctggcgctggcg
ggcgaccgctcgacagtgcgcttgctgatcacggcaggcgaaggcatcgcgccggagcac
ttcaactggttcctgcaacgcttcggcgacggcacggcgcccgtcatcaactacacgggc
ggcacggaggcttccggcgccttgctcgccagcgtgccgatccgcccgattccaccgagc
ggcttcaacacggtctcgcccggcgtcgcggcggacgtggtgaatgccgagggcgaaagc
gtgacgggcgttgtgggcgaactggccatgcgagcgcccttcgtcggcatgacgcactcg
ttctggcgcgacgacgagcgctatctggaaacctactggcagaccattccgggaatctgg
gtgcatggcgacctggcgctgcgcacgcccgagggcaactacttcatgatgggacgctcc
gacgacacgctcaaggtcgccggcaagcgcctcggaccggccgaagtggaagaagtcgtg
ctggaactggccgacgtatccgaagcggctgcaatcggcgtggcggatgccgacaagggg
cagaagctcgtcgtctttgtcgtgccgaagcccgacgcgagcgtcgtggccgcggagttg
acgtcgatcgtctcggctcatgtcgacaagcgcctcgggcggccgttccgccccggctgc
gtgcatgtcgtcgcgcaactgccgaagacgcgcagttccaagatcatgcggcgcgtgatc
cgcagcgtgtattgcggcttgccgcccggcgatctgtcgtcgctggacaatcccgccgcg
ctcgacgaagtgcgctcggctgcgagctccggctga

DBGET integrated database retrieval system