KEGG   Burkholderia sp. YI23: BYI23_D007380Help
Entry
BYI23_D007380     CDS       T01711                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
byi  Burkholderia sp. YI23
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:byi00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:byi00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
byi_1p:complement(842682..843836)
Genome map
AA seq 384 aa AA seqDB search
MANTNKALIVSAALASAMWMPLRAAAASIASAPYGATQQGQAVVQYTLSNARGVTMNCIT
YGGIVTRLDVPDRRGRRADIVLGFGSLGDYEKYNGKIHFGGLVGRYANRIADGRFDLDGH
TYKLPVNEPPNTLHGGPHGFDEKVWTVVRTFQGTQGAGVQLRYVSKDGENGFPGTLTVDV
TYTLTDDNEVRIDYRAKTDKPTVVNLTNHSYFNLAGEGSGSVEGQLVMIAGSGYTPTRPD
SIPTGEIASVENTPLDLRALTPIGARLRSSSQQMRFAHGYDHNWKLNKNGQHNGEATFAA
RAYDPSSGRVLDVYTTQPGLQFYTGNGLDGSVIGASGTAYRQTDGFALETQHFPDSPNHP
AFPSTELRPGDEFHEVTVWKIGVR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacacgaacaaggcgctcatcgtttccgcggctttagcctcggcaatgtggatg
ccgttgcgcgcagcggcggcgtcgattgcgtccgcaccgtatggcgcgacgcagcaaggg
caggccgtcgtgcaatacacgctctcgaatgcgcgcggcgtgacgatgaactgcatcacc
tatggcggcatcgtcacgcggctcgatgtgccggaccggcgcggacgccgcgcggatatc
gtgctgggcttcggctcgcttggcgactatgagaagtacaacggcaagattcatttcggc
ggcttggtcgggcgctatgcgaaccgcatcgccgacggacgcttcgacctcgatggacac
acctacaagttgcccgtcaacgagccgccgaacacgctgcacggcggcccgcacggtttc
gacgaaaaagtctggaccgtggtcaggacgtttcagggtacacagggcgcgggcgtgcag
cttcgttatgtgagcaaggacggcgaaaacggctttcccggcacgctgaccgtggatgtc
acttacacgctcacggacgacaacgaagtgcgcatcgactaccgcgcgaagacggacaag
ccgacggtcgtgaacctcacgaatcacagctacttcaatcttgcgggcgagggcagcggc
agtgtcgaagggcagctcgtgatgatcgcgggatcgggctatacgccgacgcgtcccgat
tcgattccgacgggcgagatcgcgagtgtcgagaatacgccgctggatctgcgcgcgctg
acgccgatcggcgcacggctgcggtcgtcgagccagcagatgcgttttgcgcacggctac
gaccacaactggaagctcaacaagaatggccagcacaatggcgaggcgacctttgcggcg
cgcgcctacgatccgtcgagcggacgcgtgctggatgtctacacgacccagcccggcctg
cagttctacacgggcaatggtctcgatggcagcgtgatcggcgcgtcgggcacggcgtac
cggcaaaccgatggctttgcgctcgaaacccagcatttccccgattcgccgaatcatccg
gcgtttccctcgaccgaactcaggcccggcgacgagtttcacgaagtcacagtctggaag
atcggcgtgcgttga

DBGET integrated database retrieval system