KEGG   Burkholderia sp. YI23: BYI23_D008930Help
Entry
BYI23_D008930     CDS       T01711                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00010  Glycolysis / Gluconeogenesis
byi00052  Galactose metabolism
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
byi01120  Microbial metabolism in diverse environments
byi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BYI23_D008930
   00052 Galactose metabolism
    BYI23_D008930
Enzymes [BR:byi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BYI23_D008930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AET94403
UniProt: G8MNL4
Position
byi_1p:1022023..1023093
Genome map
AA seq 356 aa AA seqDB search
MKSPRGHEIIASMTTSSIDVRPWGDVHLYTLRNASGMRVAISDLGATLVSWLAPDREGRF
ADILLGHDTPEQYRNGRAFLGAIIGRWANRIRDGRFVLDGVAYQVERNEGANHLHGGAEG
FHRQMWHAELHDGALVMTLHSPAGAAGFPGNLSVTVRYALADDGTLSIDYTARTDAATPV
SLTNHAYFNLGDDASIREHEISIAADTYFAIDALSIPVAREDVTNTVFDLRAPASIGARL
EAGLRTSNAQFAIAGGFDHCYALGNDASEPRHVAVLFDPSSGRELSVSTDARGLQFYSGN
YLEGVPARNGARYRKQAGLCLEAGGFPNEINMDGERAVLRPGDVYRQRTRYTLRVR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgccgcgcggccatgagatcatcgcaagcatgacgacatcttccatcgacgtt
cgcccgtggggcgacgtgcatctctacacgctgcgcaatgcatcgggcatgcgcgtggcg
atcagcgatctcggcgcgacgctcgtgtcatggctcgcgccggatcgcgaaggccgtttt
gccgatatcctgctcggccacgacacgcccgagcaatatcgcaacggcagggcgttcctg
ggcgcgatcatcgggcgctgggccaaccgcatccgcgatgggcgcttcgtgctcgatggg
gtcgcttatcaggtcgagcgcaacgaaggcgcgaatcatctgcatggcggtgcggaaggc
tttcatcggcagatgtggcatgcggagttgcatgacggcgcgctcgtcatgacgctgcat
tcgcccgcgggcgcggccgggtttcccggcaatctgagcgtgaccgtgcgctatgcgctc
gccgatgacggcacgctctccatcgactacaccgcgcgcaccgatgcggcgacgcccgtc
agtctgacgaaccatgcgtacttcaatctgggcgacgacgcgagcatacgcgagcatgaa
atttcgatcgccgccgatacgtacttcgcgatcgatgcattatcgattcccgtcgcgcgc
gaagacgtgacgaacacggtgttcgatttgcgcgcgcccgcatcgatcggtgcgcggctc
gaagccggattgcgcacatcgaacgcgcagttcgccatcgcgggcggcttcgatcattgc
tatgcattgggcaacgatgcgagcgagccgcgccacgtagccgtgctgttcgatccatcg
agcggacgcgaactgagcgtctcgaccgacgcgcgcggactgcagttctactcgggaaat
tatctggaaggcgtgcccgcacgcaacggggcgcgctatcgcaagcaggcggggctgtgt
ctcgaagcgggcggatttccgaacgaaatcaacatggacggcgagcgcgccgtcctgcgt
cctggcgatgtgtatcgtcagcgcacgcgctatacgctgcgcgtgcgctga

DBGET integrated database retrieval system