KEGG   Burkholderia sp. YI23: BYI23_D009230Help
Entry
BYI23_D009230     CDS       T01711                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
byi  Burkholderia sp. YI23
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BYI23_D009230
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BYI23_D009230
   00630 Glyoxylate and dicarboxylate metabolism
    BYI23_D009230
Enzymes [BR:byi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BYI23_D009230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
byi_1p:1052902..1055079
Genome map
AA seq 725 aa AA seqDB search
MNDMIKQHGLQVDASLAKFVDEEAIPGTGVDSASFWKGFDAIVHDLAPKNRALLAERDRL
QTALDDWHRSNPGPVRDPRAYRKVLEEIGYIVSAPAHVQASTANVDREIAEQAGPQLVVP
LSNLRYALNAANARWGSLYDALYGTDAIDESGGAERTAQFNPKRGAKVIAYARAFLDDNA
PLAHGSHADATKYSVEQGKLAVTLKDGAKSGLANAEQFAGYQGDAKEPSAILLKHNDLHF
EIQIDANHSIGKTDAAHVKDVLMEAAVSTIIDCEDSVAAVDAADKTQLYRNWLGLMQGHL
SEQVTKNGKSFTRSMNPDREYAAPNGGTIKLHGRSLLFIRNVGHLMTNPAVLDRDGNEIP
EGILDGVMTTLGAMHDLKNKMNSRTGSIYIVKPKMHGPAEVAFADELFSRVEDLLGLPRH
TIKMGIMDEERRTSVNLKACIAAAGARVAFINTGFLDRTGDEMHSSMEAGPMMRKGDMKS
SKWIGSYERSNVLVGLNTGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPRAGANTAWVPSP
TAATLHALHYHMVDVQQVQQELESIDYDSQKNELLDGLLTIPVVDKPSWSEDDIRNEIEN
NAQGILGYVVRWVDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGIVTEEQVRA
TLERMAAVVDKQNEADPTYTPMAPSFDSSFAFKAACALVFEGRTQPSGYTEPLLHKFRQA
VKQSM
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatgatcaaacaacacggcctgcaggtcgacgcgagcctcgcgaagttcgtc
gatgaagaagccatccccggcacgggcgtcgacagcgcgtccttctggaagggtttcgat
gcgatcgtgcacgacctcgcgccgaaaaaccgcgccctgctcgccgagcgcgaccgcctt
cagaccgcgctcgacgactggcatcgcagcaatcccggcccggtgcgcgatccgcgcgcg
tatcgcaaggttctggaggaaatcggctatatcgtgtccgcgcccgcgcatgtgcaggcg
agcaccgccaatgtcgatcgcgaaatcgccgagcaggccggcccgcaactcgtcgtgccg
ctctccaatctccgctatgcgctcaacgccgccaacgcgcgctggggcagcctctacgac
gcgctctacggcaccgacgccatcgacgaatccggcggcgcggagcgcaccgcgcaattc
aatccgaagcgcggcgcgaaagtgatcgcctacgcgcgcgccttcctcgacgacaacgcg
cccctcgcccacggctcgcacgccgatgcgacgaaatacagcgtcgagcagggcaagctc
gccgtcacgctgaaggacggcgcgaaaagcggtctcgcgaacgccgaacagttcgcgggc
tatcagggcgatgcgaaggaaccgtccgccattctgctcaagcacaacgacctgcacttc
gagatccagatcgacgcgaaccattccatcggcaaaacggacgccgcgcacgtgaaagac
gtgctgatggaagcggccgtgagcacgatcatcgattgcgaagactcggtcgcggccgtc
gatgccgccgataagacgcagctctatcgcaactggctcggtctgatgcaaggccatctc
tccgaacaggtgacgaagaacggcaagagcttcacgcgcagcatgaacccggatcgcgaa
tacgccgcgcccaatggcggcacgatcaagctgcacggacgttcgctcttgtttatccgc
aacgtcggccatctgatgacgaatcccgccgtgctcgaccgcgacggcaacgaaattccg
gagggcattctcgacggcgtgatgaccacgctcggcgcaatgcacgatctcaagaacaag
atgaactcgcgcacgggttccatctacatcgtgaagccgaagatgcacggcccggcggaa
gtcgcgttcgcggacgaactattctcgcgcgtcgaagacctgctcggcctgccgcgtcac
acgatcaagatgggcatcatggacgaggaacgccgcacgagcgtcaacctcaaggcctgc
atcgcggcggcgggcgcgcgcgtcgcgttcatcaacacgggcttcctggatcgcaccggc
gatgaaatgcattcgtcgatggaagccggcccgatgatgcgcaagggcgacatgaagtcg
tcgaagtggatcggttcgtacgagcgcagcaacgtgctggtcggcctgaacacgggcttg
cgcggacgcgcgcagatcggcaagggcatgtgggccatgcccgatctcatgcacgcgatg
ctcgaacagaagatcgcgcatccgcgggcgggcgcgaacaccgcgtgggtgccctcgccc
acggcggccacgctgcacgcgctgcactatcacatggtcgatgtgcagcaggtccagcag
gaactcgaaagcatcgactacgacagccagaaaaacgagctgctggatggcttgctgacg
attcccgtcgtcgataaaccgtcgtggtcggaagacgacatccggaacgaaatcgagaac
aatgcgcagggcattctcggttacgtggtgcgctgggtcgatcagggcgtcggctgctcg
aaggtgccggacattcacgatgtcggcctgatggaagaccgcgcgacgctgcgcatctcc
agccagcacatcgcgaactggctgaggcatggcatcgtcacggaagagcaggttcgcgcg
acgctcgaacgcatggccgccgtggtcgacaagcagaacgaagccgatccgacctatacg
ccgatggcgccttcgttcgacagctcattcgcgttcaaggccgcatgcgcgctcgtgttc
gagggacgcacgcagccgagcggctatacggaaccgctgctgcacaagttccgtcaggcc
gtgaagcaatcgatgtaa

DBGET integrated database retrieval system