KEGG   Burkholderia sp. YI23: BYI23_D011430Help
Entry
BYI23_D011430     CDS       T01711                                 

Definition
branched-chain alpha-keto acid dehydrogenase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
byi  Burkholderia sp. YI23
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BYI23_D011430
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BYI23_D011430
   00020 Citrate cycle (TCA cycle)
    BYI23_D011430
   00620 Pyruvate metabolism
    BYI23_D011430
Enzymes [BR:byi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BYI23_D011430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
byi_1p:1304871..1305995
Genome map
AA seq 374 aa AA seqDB search
MAAITPIVMPKWGLSMKEGTVNEWLVEEGTEITVGMPILDVETDKIANAVEAPDAGLLRR
RVAAAGDVLPVKALLGVLAPSSVSDAEIDEYVSSYVTPADDEEEGEEAAAYHFVDVDGIR
VRYASRGGDDAARSAVLFLHGFGGDLDNWLFNLDALAEKNRVFALDLPGHGQSTPNVPGT
SLAALASFVGKFMDAVGIERAHLVGHSMGGGIAAQMAVDSPARVQSVSLISPAGFGDEVN
NAYTEGFVTAESRRELKPVVELLFANPELVSRQMLDDLLKYKRLDGVSDALTSLNAGLFA
GGKQSAQPGGQLAESGKPVLVIWGAKDQIIPAAHAKNAPQGATVKVFDDAGHMSQMEKAN
EVNALLKEQVGKGG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaatcacaccgatcgtcatgcctaagtggggcttgtcgatgaaggaaggcacg
gtcaacgaatggctcgtggaggagggcacggagattaccgtcggcatgccgattctcgat
gtcgaaaccgacaagatcgccaacgcggtcgaagcgcccgatgcgggtctgctacggcgg
cgggtcgcggcggcgggcgatgtgctgccggtgaaagcgttgctcggcgtgctcgcgcct
tcttcagtgagcgatgcggaaatagacgagtacgtgtcgtcctacgtcacgcccgccgac
gacgaggaagaaggcgaagaagcggcggcgtatcacttcgtcgatgtggacggtatccgc
gtgcgctacgcctcgcgcggcggcgacgatgcggcgcgttcagcggtgctgtttcttcac
ggcttcggcggcgatctcgacaactggctattcaacctcgacgcattggccgaaaagaac
cgcgtgttcgcgctggacttgccgggccacgggcaatccacgccgaacgtgccggggacg
tcgcttgcggcgctggcgtcgttcgtcggcaagttcatggacgcggtcggcatcgagcga
gcgcatctcgtcggccattcgatgggcggcggcatcgcggcgcagatggccgtcgattcg
cccgcgcgcgtgcaatcggtgtcgctgatatcgcccgccggtttcggcgacgaagtgaac
aatgcgtacaccgaaggcttcgtcacggcagagtcgcgtcgcgaactgaagccggtggtc
gaactgttgttcgcgaatcccgaactggtgagccgccagatgctcgacgatctcctgaag
tacaagcggctcgacggcgtgtcggacgcgctgacatcgctcaatgcgggattgttcgcg
ggcgggaaacaaagcgcgcagccgggcggacagctcgcggaatcgggcaagccggttttg
gtcatctggggtgcaaaggaccagatcattccggccgcgcacgcgaaaaatgcgcctcaa
ggcgcgaccgtgaaagtgttcgacgatgccgggcacatgagccagatggagaaggcgaac
gaggtgaacgcgttgctgaaggagcaggtgggcaagggcggctga

DBGET integrated database retrieval system