KEGG   Burkholderia sp. YI23: BYI23_D012560Help
Entry
BYI23_D012560     CDS       T01711                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00071  Fatty acid degradation
byi00280  Valine, leucine and isoleucine degradation
byi00281  Geraniol degradation
byi00310  Lysine degradation
byi00360  Phenylalanine metabolism
byi00362  Benzoate degradation
byi00380  Tryptophan metabolism
byi00410  beta-Alanine metabolism
byi00627  Aminobenzoate degradation
byi00640  Propanoate metabolism
byi00650  Butanoate metabolism
byi00903  Limonene and pinene degradation
byi00930  Caprolactam degradation
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
byi01120  Microbial metabolism in diverse environments
byi01130  Biosynthesis of antibiotics
byi01212  Fatty acid metabolism
Module
byi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BYI23_D012560
   00650 Butanoate metabolism
    BYI23_D012560
  Lipid metabolism
   00071 Fatty acid degradation
    BYI23_D012560
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BYI23_D012560
   00310 Lysine degradation
    BYI23_D012560
   00360 Phenylalanine metabolism
    BYI23_D012560
   00380 Tryptophan metabolism
    BYI23_D012560
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BYI23_D012560
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BYI23_D012560
   00281 Geraniol degradation
    BYI23_D012560
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BYI23_D012560
   00627 Aminobenzoate degradation
    BYI23_D012560
   00930 Caprolactam degradation
    BYI23_D012560
Enzymes [BR:byi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BYI23_D012560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Carboxyl_trans
Motif
Other DBs
NCBI-ProteinID: AET94766
UniProt: G8MJX6
Position
byi_1p:1432320..1433186
Genome map
AA seq 288 aa AA seqDB search
MTGSIDYVAKDGRAYITINRPEKKNAMTSAMLDQLMDGYDRAEADDDVRVVVLQGAGDDF
TTGHDLAEVGTEYGETTFDDKGRARKPSQRARLLHDKRYIERFERIFKFLKPTLSLVKGY
CLGGGLYLAEASDLVIAADTAKMGHPEQKLGLSGAAYFAAWEMMTLGPRKARELLLMADV
WDAQTCVANGLVNKVVPRASLTDAGEEWAERIVRLPRDGIVMGKAATNLAMNALGIDAQF
SYGHVLHALATNVRYESDEYNFMKQRRDKGVRASNHERETFYTEKDKA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcagcatcgattacgtcgcgaaggacggccgggcttacatcacgatcaaccgc
ccggagaagaagaacgcgatgacgagcgccatgctcgatcaactcatggacggctacgac
cgcgccgaagccgacgacgacgtgcgcgtggtcgtgctgcaaggcgcgggcgacgacttc
acgaccggccacgatctggccgaagtgggcacggaatacggcgagaccacgttcgacgac
aagggccgtgcgcgcaagccgagccagcgcgcgcggctgttgcacgacaagcggtatatc
gaacgcttcgagcggatcttcaagtttctcaagccgacgctctcgctggtgaagggctat
tgcctcggcggcggcttgtatctggccgaagcgtcggatctcgtcatcgcggcggacacc
gccaagatggggcatccggagcagaagttggggctgtccggcgcggcctacttcgcggcc
tgggaaatgatgacgctcggcccgcgcaaggcgcgcgaactgctgctgatggccgacgtc
tgggatgcgcagacctgcgtcgcgaacgggcttgtcaacaaggtcgtgccgcgcgcgtcg
cttacagacgcgggcgaagaatgggcggagcgcatcgtgcgtttgccgcgcgacggcatc
gtgatgggcaaggccgccacgaatctggcgatgaacgcgctcggcatcgacgcgcaattc
tcgtacggacacgttctgcatgcgctcgccaccaatgtgcgctacgaatccgacgaatac
aacttcatgaagcagcgccgcgacaagggcgtgcgcgcgtcgaaccatgaacgcgaaacg
ttctacaccgaaaaggacaaggcatga

DBGET integrated database retrieval system