KEGG   Burkholderia sp. YI23: BYI23_D012560Help
Entry
BYI23_D012560     CDS       T01711                                 

Definition
putative enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
byi  Burkholderia sp. YI23
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BYI23_D012560
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BYI23_D012560
   00650 Butanoate metabolism
    BYI23_D012560
  Lipid metabolism
   00071 Fatty acid degradation
    BYI23_D012560
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BYI23_D012560
   00310 Lysine degradation
    BYI23_D012560
   00360 Phenylalanine metabolism
    BYI23_D012560
   00380 Tryptophan metabolism
    BYI23_D012560
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BYI23_D012560
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BYI23_D012560
   00281 Geraniol degradation
    BYI23_D012560
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BYI23_D012560
   00627 Aminobenzoate degradation
    BYI23_D012560
   00930 Caprolactam degradation
    BYI23_D012560
Enzymes [BR:byi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BYI23_D012560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
byi_1p:1432320..1433186
Genome map
AA seq 288 aa AA seqDB search
MTGSIDYVAKDGRAYITINRPEKKNAMTSAMLDQLMDGYDRAEADDDVRVVVLQGAGDDF
TTGHDLAEVGTEYGETTFDDKGRARKPSQRARLLHDKRYIERFERIFKFLKPTLSLVKGY
CLGGGLYLAEASDLVIAADTAKMGHPEQKLGLSGAAYFAAWEMMTLGPRKARELLLMADV
WDAQTCVANGLVNKVVPRASLTDAGEEWAERIVRLPRDGIVMGKAATNLAMNALGIDAQF
SYGHVLHALATNVRYESDEYNFMKQRRDKGVRASNHERETFYTEKDKA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcagcatcgattacgtcgcgaaggacggccgggcttacatcacgatcaaccgc
ccggagaagaagaacgcgatgacgagcgccatgctcgatcaactcatggacggctacgac
cgcgccgaagccgacgacgacgtgcgcgtggtcgtgctgcaaggcgcgggcgacgacttc
acgaccggccacgatctggccgaagtgggcacggaatacggcgagaccacgttcgacgac
aagggccgtgcgcgcaagccgagccagcgcgcgcggctgttgcacgacaagcggtatatc
gaacgcttcgagcggatcttcaagtttctcaagccgacgctctcgctggtgaagggctat
tgcctcggcggcggcttgtatctggccgaagcgtcggatctcgtcatcgcggcggacacc
gccaagatggggcatccggagcagaagttggggctgtccggcgcggcctacttcgcggcc
tgggaaatgatgacgctcggcccgcgcaaggcgcgcgaactgctgctgatggccgacgtc
tgggatgcgcagacctgcgtcgcgaacgggcttgtcaacaaggtcgtgccgcgcgcgtcg
cttacagacgcgggcgaagaatgggcggagcgcatcgtgcgtttgccgcgcgacggcatc
gtgatgggcaaggccgccacgaatctggcgatgaacgcgctcggcatcgacgcgcaattc
tcgtacggacacgttctgcatgcgctcgccaccaatgtgcgctacgaatccgacgaatac
aacttcatgaagcagcgccgcgacaagggcgtgcgcgcgtcgaaccatgaacgcgaaacg
ttctacaccgaaaaggacaaggcatga

DBGET integrated database retrieval system