KEGG   Burkholderia sp. YI23: BYI23_D013080Help
Entry
BYI23_D013080     CDS       T01711                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
byi  Burkholderia sp. YI23
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BYI23_D013080
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BYI23_D013080
   00620 Pyruvate metabolism
    BYI23_D013080
   00640 Propanoate metabolism
    BYI23_D013080
  Energy metabolism
   00680 Methane metabolism
    BYI23_D013080
Enzymes [BR:byi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BYI23_D013080
Lipid biosynthesis proteins [BR:byi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BYI23_D013080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
byi_1p:complement(1487969..1489576)
Genome map
AA seq 535 aa AA seqDB search
MLPPGHAYEAVAGQFEWRIPARYNIAQDVCDKWADGSGRLALIVEAADASQQRYTFDDLK
HLSNRFANAMKAQGVARGDRVAIFVRQSVEAAIAHLAAYRMGCIAVPLFALFGIDAIEFR
LAHSGAKAVVTDAEGAAKIAQVRGALPALQHLFDTDTNFWPAIETASDDDALVDTAADDP
AVIIYTSGTTGKPKGALHGHRILPGHLPGVEMSQQCFPRDATLFWTPADWAWIGGLFDVL
MPSWHHGVPVLARRFDKFDGVAAFDLLARHKVSHTFLPPTALKMMRATPHAKRDGLALRS
VASGGESLGEELLSWGRAMLGVTINEFYGQTECNMVLSSCETWFEPRNGAIGRAVPGHRV
AIVDDDGVPVPNGTQGHIAIARPDPVMFLGYWRDEAATAQKFRGDFLLTGDLGTLDGDGF
FRFIGRDDDVITSAGYRIGPGPIEDCLLRHPAVRFAAVIGVPDAQRTEIVCAAVVLNEGF
EPGAALVRELQEHVRTRLAAHEYPRDVRFVSELPMTATGKVIRKSLRTQFAGDER
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctcccgccaggccacgcctatgaagccgtcgcaggtcagttcgaatggcgcattccc
gcgcgctacaacatcgcgcaggatgtgtgcgacaaatgggccgacggctcgggccgtctc
gcgctgatcgtcgaagccgccgatgcctcgcaacagcgctataccttcgacgacctcaaa
cacctctccaaccgcttcgccaacgcgatgaaagcgcaaggcgtcgcgcgtggcgaccgc
gtggcgatcttcgtgcggcaatcggtcgaagcggcgatcgcgcatctcgccgcgtatcgc
atgggctgcatcgcggtgccgctcttcgcgctgttcggcatcgatgccatcgagttccgg
ctcgcgcattcgggcgcgaaggccgtcgtcacggatgccgagggcgccgctaaaatcgcg
caggttcgcggcgcgctgccggcgttgcagcacctcttcgacaccgacacgaacttctgg
cccgcgatcgaaaccgcatccgacgacgacgcgctcgtcgataccgccgcggacgatccc
gccgtcatcatttatacgtccggcacgacgggcaagccgaagggcgcgctgcacgggcat
cgcattctgccgggccacttgccgggcgtggaaatgtcgcagcagtgctttccgcgagac
gccacgctgttctggacgcccgcggactgggcatggatcggcgggctgttcgacgtgctc
atgccctcgtggcatcacggcgtgccggtgctcgcgcgccgcttcgacaagttcgacggc
gtcgccgcgttcgatctgctcgcgcgccacaaggtgagtcacacgttcctgccgccgacc
gcgctcaagatgatgcgcgcgacgccccacgcgaagcgcgacggtctcgcgttgcgctcg
gtggcgagcggcggcgaatcgctcggcgaagagttgctgtcgtgggggcgcgccatgctc
ggcgtcaccatcaacgagttctacgggcagaccgaatgcaacatggtgctgtcgtcgtgc
gaaacatggttcgagccgcgcaacggcgcgatcggccgcgcggtgccggggcatcgcgtc
gcgatcgtcgatgacgacggcgtgcccgtgccaaacggcacgcaaggacacatcgcgata
gcgcggcccgatccggtcatgttcctcggctactggcgcgacgaagccgcgaccgcgcag
aagtttcgcggcgatttcctgttgacgggcgatctcggcacgctcgacggcgacggcttc
ttccgcttcatcggccgcgacgacgatgtcattacgagcgcgggctatcgcatcgggccg
ggtccgatcgaggattgcctgctcaggcatccggcggtgcgcttcgcggcggtcatcggc
gtgccggatgcgcagcgcacggagatcgtgtgcgcggccgtcgtgttgaacgagggcttc
gaacccggcgctgcgctcgtgcgcgaattgcaggaacacgtccgcacacgcctcgcggcg
cacgaatatccgcgcgacgtgcgcttcgtctccgaactgccgatgacggccacgggcaag
gtcatccgcaagtcgctgcgcacgcagttcgcgggcgatgaacgttga

  All links  
No link information was found.   
DBGET integrated database retrieval system