KEGG   Burkholderia sp. YI23: BYI23_E002680Help
Entry
BYI23_E002680     CDS       T01711                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
byi  Burkholderia sp. YI23
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
byi_2p:complement(228585..229688)
Genome map
AA seq 367 aa AA seqDB search
MEWLGFRGARGGRSADGKAAFANGAGNVFQQARRHLLDEIAAFLLTYELDVTPNNLLTAH
GAFSGSNPALARKIAQHVTAGLAVTQEWLDEITAADETIDKHDGIQHLMARLETTLESFS
KNANATRSATADYTDELEQHVAELDQVQGTGQILSSLADLAKAMLERTRKLETDMRRSEE
EAKALRRSLEQARREAEIDHMTGLPNRRAFETVLEREYRDARASFDPLTVAFCDIDHFKR
INDTHGHDAGDRVIRLIAEMLATISDDNCHVARHGGEEFVMLFRGVSLSEAHKKLDGLRE
QMAERRLRNRKTDEPLGQITFSAGIADVFDFPDPRAALKAADEALYAAKQGGRNQVIIAP
KGGAQAA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
ctggaatggcttggctttcgcggcgcgcgcggggggcgcagcgcggacgggaaagcagcg
ttcgcaaacggcgctggcaatgtcttccagcaggcgcgccgccatctgctcgatgaaatt
gcggccttcctgctcacctatgagctggacgtgacgcccaataatcttctcaccgcgcac
ggggccttttccgggtccaatcccgcccttgcgcgcaagatcgcccagcatgtgaccgct
ggcctagccgtgacacaggaatggctggacgaaatcacggcggcagacgagacgatcgac
aagcacgatggcatccagcacctcatggcgaggttggaaacgacgcttgaaagtttctcg
aagaacgccaacgccacgcgcagcgcgacggccgattataccgacgagctggaacagcat
gtggccgagctggatcaggttcagggaacggggcaaatcctttccagcctagccgatttg
gcgaaggcgatgcttgagcgaacccgcaagctggaaaccgacatgcggcgcagcgaggag
gaggccaaggcgctccgccgtagtctggaacaggcgcggcgcgaggcggagattgaccac
atgaccggccttcccaatcgccgggctttcgagacggtcctagagcgggaatatcgtgac
gccagagcgagctttgacccgctgaccgtagctttctgcgatatagaccattttaagcgc
atcaatgatacgcacggccatgatgcaggcgatcgggtcattcgacttatcgcggaaatg
cttgctacgatttcggacgataattgccatgtagcgcgccacggtggagaggagtttgtt
atgctgttccgaggcgtcagcctgtccgaagcgcataagaaacttgacggcttgcgcgaa
caaatggccgaacgtcgcttgcgaaaccgcaagacggatgaaccattgggccaaattaca
ttctccgctggtattgcggacgtgtttgattttcctgatccaagggcggccctcaaagcg
gccgatgaagccctttacgccgcaaaacagggcggccgaaaccaagtgataatcgcaccc
aagggaggcgcgcaggccgcatga

DBGET integrated database retrieval system