KEGG   Burkholderia sp. YI23: BYI23_E002680Help
Entry
BYI23_E002680     CDS       T01711                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
byi  Burkholderia sp. YI23
Brite
Enzymes [BR:byi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     BYI23_E002680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
byi_2p:complement(228585..229688)
Genome map
AA seq 367 aa AA seqDB search
MEWLGFRGARGGRSADGKAAFANGAGNVFQQARRHLLDEIAAFLLTYELDVTPNNLLTAH
GAFSGSNPALARKIAQHVTAGLAVTQEWLDEITAADETIDKHDGIQHLMARLETTLESFS
KNANATRSATADYTDELEQHVAELDQVQGTGQILSSLADLAKAMLERTRKLETDMRRSEE
EAKALRRSLEQARREAEIDHMTGLPNRRAFETVLEREYRDARASFDPLTVAFCDIDHFKR
INDTHGHDAGDRVIRLIAEMLATISDDNCHVARHGGEEFVMLFRGVSLSEAHKKLDGLRE
QMAERRLRNRKTDEPLGQITFSAGIADVFDFPDPRAALKAADEALYAAKQGGRNQVIIAP
KGGAQAA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
ctggaatggcttggctttcgcggcgcgcgcggggggcgcagcgcggacgggaaagcagcg
ttcgcaaacggcgctggcaatgtcttccagcaggcgcgccgccatctgctcgatgaaatt
gcggccttcctgctcacctatgagctggacgtgacgcccaataatcttctcaccgcgcac
ggggccttttccgggtccaatcccgcccttgcgcgcaagatcgcccagcatgtgaccgct
ggcctagccgtgacacaggaatggctggacgaaatcacggcggcagacgagacgatcgac
aagcacgatggcatccagcacctcatggcgaggttggaaacgacgcttgaaagtttctcg
aagaacgccaacgccacgcgcagcgcgacggccgattataccgacgagctggaacagcat
gtggccgagctggatcaggttcagggaacggggcaaatcctttccagcctagccgatttg
gcgaaggcgatgcttgagcgaacccgcaagctggaaaccgacatgcggcgcagcgaggag
gaggccaaggcgctccgccgtagtctggaacaggcgcggcgcgaggcggagattgaccac
atgaccggccttcccaatcgccgggctttcgagacggtcctagagcgggaatatcgtgac
gccagagcgagctttgacccgctgaccgtagctttctgcgatatagaccattttaagcgc
atcaatgatacgcacggccatgatgcaggcgatcgggtcattcgacttatcgcggaaatg
cttgctacgatttcggacgataattgccatgtagcgcgccacggtggagaggagtttgtt
atgctgttccgaggcgtcagcctgtccgaagcgcataagaaacttgacggcttgcgcgaa
caaatggccgaacgtcgcttgcgaaaccgcaagacggatgaaccattgggccaaattaca
ttctccgctggtattgcggacgtgtttgattttcctgatccaagggcggccctcaaagcg
gccgatgaagccctttacgccgcaaaacagggcggccgaaaccaagtgataatcgcaccc
aagggaggcgcgcaggccgcatga

DBGET integrated database retrieval system