KEGG   Burkholderia sp. YI23: BYI23_E002890Help
Entry
BYI23_E002890     CDS       T01711                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
byi  Burkholderia sp. YI23
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
byi_2p:244320..245036
Genome map
AA seq 238 aa AA seqDB search
MKKFAAALLLAGLSVAAFASPETDSVLATLKSKYPNTNFTSIEASPLPGIYELTMGKNIA
YTDKEGHYFLFGSLYDMEKRQDLTAPKREAASKIDVSKLPLKDAIVRVKGKGTRKLYLFT
DPDCPFCKELERDTLPKLDDVTIYTFMFPLDSLHPQARAKSESIWCLPEKERGAAWDKLL
TTGTPPAMAKCDNPLAALSSLGDSLGVRGTPTMFSEDGRILPGAAAPERIDAFLNAGK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtttgctgctgcactcctgctggccggcctgtcggtcgctgcattcgcgtcg
cccgaaacggacagcgttctcgcgacgctcaagtcgaagtatccgaatacaaacttcacc
tcgatcgaggcctcgccgctgccgggcatctacgaactgacgatgggaaaaaacatcgcc
tacacggacaaggaaggtcattacttcctgttcggtagcctgtacgacatggaaaagcgt
caggatctgacggcgccgaagcgcgaagcggccagcaagatcgacgtgagcaagctgccg
ctgaaagacgccatcgtgcgggtgaaaggcaaaggcacgcgcaagctgtacctcttcacg
gaccccgactgcccattctgcaaggaactcgagcgcgataccctgccgaagctcgacgac
gtgacgatctacacgttcatgttccccctcgattcgctgcatccgcaggcacgcgcgaaa
tcggaatcgatctggtgcctgcccgagaaagagcgcggtgccgcctgggacaagctgctg
accaccggcacgccgccggcaatggcgaagtgcgacaacccgctggcggcgctgtcgtcg
ctgggcgacagcctcggtgtccgtggcacgccgacgatgttcagcgaagacgggcgcatc
ttgccgggcgcggcagcgccggagcgtatcgacgcattcctgaacgcaggcaagtaa

DBGET integrated database retrieval system