KEGG   Burkholderia sp. YI23: BYI23_F000330Help
Entry
BYI23_F000330     CDS       T01711                                 

Definition
DNA helicase/exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
byi  Burkholderia sp. YI23
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:byi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BYI23_F000330
Enzymes [BR:byi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BYI23_F000330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
byi_3p:42823..45003
Genome map
AA seq 726 aa AA seqDB search
MSSPFFAVVTDTPFDARRALENAQDAMQLLGHWVERGWLREIDAAFANFLAHEAQEASGL
VILAAALASHQLGRGHACLDLAAALFNPTLALSLPPAGACVPGADHDDGDAERALLPLSV
LNGVTLSRWTGALKRSALVSAGDASNDTPLVLTEPTSNPKPRLYLRRYWRYEQDVCRAIG
ERIAPAKTPDTAWLRSALDALFPPPAAARTVDQAENTDHADWQKLACALAAKNAFSIVTG
GPGTGKTTTVVKLLALLQAEALARNDDPPPLRIRLAAPTGKAAARLNESIAGAVAKLPLD
AFPHADEIRKAIPVNVTTLHRLLGTVPGSRRFRHHAGRPLSLDVLVIDEASMVDLEMMNA
VLVALPARARLVLLGDKDQLASVEAGAVLGELCSGAAGAHYTADTRAWLEAASGERVDAR
YGDAAGRPLDQSIAMLRKSHRFSSASEIGKLAEAVNAGQSSEIPAILATGGGDIAYVDCA
ERGDAVLGVLAIEGVAQAQGASDDLFVNASSRHGYRHYLETMHARQPPIGANDEAYDAWA
HAVLHAHGEFQLLCALRRGPWGVEGLNRRIARLLQEAGLIHARGEWYAGRPVLVTQNDYE
LGLMNGDIGITLLRREAPDNPRLHVAFAAGDGTSRIRWVLPSRLQAVETVFALTVHKSQG
SEFTHAALVLPDKISPVLTRELVYTGITRARRFLTIASAGGMALVEQAVRAQVERASGVS
EAFDTQ
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgccgtttttcgccgtcgtcaccgacactccgttcgatgcgcgccgcgcactc
gagaacgcgcaggacgccatgcagctgcttggccattgggtcgaacgcggctggctgcgc
gagatcgatgctgccttcgcgaacttcctcgcgcacgaagcgcaggaagcgtccggtctc
gtgattctcgcggccgcgctcgcgagccatcagctcgggcgcgggcacgcctgtctcgat
ctggcggcggcgctattcaatccgaccttagcgttgtcgctgccgcccgccggcgcgtgt
gtgccgggcgcggaccatgacgacggtgacgccgagcgcgcactgctgccgttgagcgtg
ctcaacggcgtgacgctgtcgcgctggaccggcgcactgaagcgctcggcgctcgtgagc
gcgggcgatgcctcgaacgacacgccgctcgtgctgacggaaccgacgtcgaacccgaag
ccgcgcctctacctgcgccgctactggcgttacgaacaggacgtgtgtcgcgcgatcggt
gaacgtatcgcgccggcgaagacgccggataccgcttggctgcgcagcgcactcgatgcg
ctgttcccgccccccgctgctgcccgaaccgtcgaccaggcagaaaacaccgatcacgcc
gactggcagaagctcgcctgcgcgctcgccgcgaagaacgcgttcagcatcgtcacgggg
ggccccggcaccggcaagacgaccacggtcgtcaagctgctcgcgctgttgcaggcagag
gcgctcgccagaaacgatgacccgccgccgttgcgcatccgcctcgcggcgccgaccggc
aaggctgcggcgcgcctgaacgagtcgatcgcgggcgcggttgcgaagctgccactcgat
gcgtttccccacgctgacgaaatccgcaaggcgattccggtgaacgtgaccacgctgcac
cggctgctcggcacggtaccgggctcccgacgctttcgccatcacgcgggccgtccgctg
tcgctcgacgtgctggtgatcgacgaagcttcgatggtcgatttggaaatgatgaacgcc
gttcttgtggcattgccggccagggcgcgcctcgtcctcctcggcgacaaagatcagctc
gcctcggtcgaggcgggcgcagtgctcggcgaattgtgtagcggagcggccggcgcacat
tacaccgccgacacgcgagcgtggctcgaagccgcgagcggcgagcgcgtcgacgcacga
tatggggatgctgccggccggccgctcgatcagtcgatcgcgatgctgcgcaagagtcat
cgcttctcgtctgcgagcgaaatcggcaagctggccgaggcggtcaacgcgggacagagc
agcgagatcccggcgatccttgcgacgggcggcggcgacatcgcgtacgtcgactgcgcc
gagcgcggcgacgccgtgctcggggtgctcgccatcgagggcgtggcgcaggcgcagggc
gcgagcgatgatctcttcgtcaatgcgtcgtcgcgccatggctatcgtcactatctggag
acgatgcatgcgcggcagcccccgattggcgccaacgacgaggcgtacgatgcgtgggcg
catgcggtgctgcacgcgcacggagagtttcaattgctgtgcgcactgcggcgcggaccg
tggggcgtggaagggctgaaccggcgcatcgcgcgcctgcttcaggaggcaggtctgatc
cacgcgcgcggcgaatggtatgcgggccggccggtgctcgtcacgcagaacgactatgag
ctcgggctgatgaacggcgacatcggtatcacactgctgcgccgcgaagcccccgacaat
ccacgcttgcacgtggcgttcgccgcgggcgacggcacgtcccgcattcgctgggtgtta
ccgagccgtctgcaggcggtcgaaacagtgttcgcgctcaccgtccacaagtcgcagggc
tcggagtttacccatgcggcgctggtgttgcccgacaagatcagcccggtgctcacgcgc
gagctggtctacacaggcatcacgcgcgcacgacgattcctgaccatcgcgagcgcgggc
ggcatggcgctcgtcgagcaggcggtgcgagcgcaagtcgagcgcgcgagcggtgtgtcg
gaagccttcgatacacagtga

DBGET integrated database retrieval system