KEGG   Bipolaris zeicola: COCCADRAFT_108534Help
Entry
COCCADRAFT_108534 CDS       T03110                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bze  Bipolaris zeicola
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bze00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    COCCADRAFT_108534
Enzymes [BR:bze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     COCCADRAFT_108534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 959 aa AA seqDB search
MLSLLLAVVPLASLVCASFDGNLNYHSPSRRHNDLGIDVPKVAKRTLSKRSAPWDPAQLN
FTHGVASGDPYPDSVILWTRIAPSLEHDRSNVTVSGYVALYNHETEKYIQASPNPICVDY
RVGTDSDLSTVVDEGQAYTTSDIDYTVKVEAKNLEPFTQYYYQFSVCGSSNKSPLGRTKT
SPDHDDDVSKVGFAVFSCSNWQNGYFNAYGNAARKDNVDFFVHLGDYIYESTKGKLGKDP
RATNPPREIVTLYDYRTRIGQYRTDDDLKLAHQNFAWIPTWDDHEIANNGYRDGFSNMNN
TEESFLKYGGISVDSRKMNAVRAYFEWMPIRQVDLDDNLRIWRNFKMGKLFDLIILDTRN
YDRSITTLDENDAYIETIRDDASRSLMGSRQENWFYNRLSESHERGATWRIVGNQIIFSR
MNNSAVYSDWLNADQWDGYTANRNRTLHHLYSNKIPNTAFLAGDSHANWVSDLVWLDETP
YDQATGEGAIGVEFAGTAVSSSGYGSGRSIANSTDRSAALVRDNRELQWTEGYYRGYYEL
FISPEELNAQYYGSPSVASRNPFDISLANFTVKAGANHLARTNGSVVAAGGYVESGALQR
GPTTPTNLTLNTVTGTWNITGIEQITNGGIEKNLQINESAPLPFLHDEQVLVQVHAMALN
PVDYKVTEGPMPLRLVGSNITPGADFCGTVAKVGRKVDEFQIGEFVFGAKVGALTNGTLA
QYVVVERTMLAVLPEGVKVEEAAGVGIVGLTEYQALVPNVKSGDKVFINGGSGGTGVFGI
QIAKALGCHVTTSCSTPNIEFCQSLGADEVIDYKTTDIVEALSAKGQVFSTVVDNVGAPD
NLYKASSAFLLPKGKFVQVGMQPSLGGTKTLVSNMLLPGFLGGGKSSFQLIMAKPSAEQL
RHMSEWLKKGSLKPIVDTVFEWEDAPKAFEKLKTGRAKGKIVIRVPQDKSKDKAADGSS
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgctctcgctcctacttgcggtcgttccgttggcttcgctcgtttgtgcatccttcgac
ggcaacttgaactaccactcgccttctcgtcggcacaatgatcttggaatagatgtaccc
aaagtcgcaaagagaactctttccaaacgctctgctccatgggacccggcccagctcaac
ttcacacatggtgttgcctctggagatccctaccctgactccgtcatcctctggacccgt
attgcaccctcgctcgaacatgacagatcaaacgttactgtttctggctacgtagcactc
tacaaccacgagacagaaaagtacatccaagcttcgccaaatcccatctgcgtcgactat
cgtgttggtacagacagcgacctctcaactgttgttgatgaaggacaagcatacaccacc
tccgacatcgactacactgtcaaggttgaagccaagaacttggagccattcacccagtac
tactatcaattcagtgtctgcggcagctccaacaaaagtcctctaggcagaaccaagact
agccctgatcatgacgacgatgtttccaaagtcggttttgcagtcttttcttgctccaac
tggcagaacggatatttcaatgcttatggaaatgctgcaagaaaggacaatgtggacttc
tttgttcatctgggcgattatatatacgagtctaccaaaggaaagctcggtaaagatcct
agagcaacgaatccgccacgcgagattgtcacactatacgactaccgaactagaattggc
cagtaccgtacggatgatgacttgaagcttgcccaccagaactttgcatggatccccaca
tgggacgaccatgaaattgccaacaacggataccgtgatgggtttagcaatatgaacaat
accgaagagagcttcttgaagtacggaggtatcagcgtcgactccagaaaaatgaacgct
gttcgagcatactttgaatggatgccgatccgccaggtcgatcttgatgacaacctccgc
atctggcgcaacttcaagatgggcaagctcttcgatctcatcatccttgatacccgcaac
tatgatcgatcaattacaaccctggatgagaatgacgcgtatatagaaacaatcagagat
gacgctagtcgctcactcatgggcagccgccaggaaaactggttctacaaccggctctcc
gagtcacatgaacgaggcgctacttggaggattgtcggtaaccagatcatcttttcgcgc
atgaacaatagtgcggtctacagcgactggctgaatgctgaccagtgggatggctacacc
gcaaaccgtaaccgtactctacaccatctctacagtaacaagatcccaaacactgcattc
ttggccggcgattcacacgccaactgggtttctgatctcgtttggctggacgaaacccca
tacgaccaggctacgggagagggtgcgattggagtcgagtttgctggcactgctgtctcc
tctagcggttacggctctggtagatcgattgcgaattcgaccgaccgctctgcagcgctc
gttcgtgacaacagggagcttcagtggacagagggttactaccgaggatactatgaactt
ttcatctcgcctgaagagctcaacgcgcagtactacggctctccttcagtcgcttctcgc
aaccctttcgacattagtctcgccaacttcactgtcaaggcgggcgctaaccacctggcg
aggactaatggctcggttgtggcagcgggcggatacgttgagagcggcgcgctccagcgt
gggccaacgactccaacgaatctgactctgaacactgttaccggcacgtggaatattacc
ggtatcgagcagatcacgaatggtggtatcgagaagaaccttcagatcaacgaatccgca
ccactacccttcctccacgatgaacaggtcctcgtccaagtccacgcaatggcactgaat
cccgtcgattacaaagtcaccgaaggccctatgccccttcgactcgtgggatccaacatc
accccgggtgctgatttctgcggcacagtggcaaaagtcggccgaaaagttgacgagttc
caaatcggcgaattcgtctttggcgcaaaagtcggtgcgctgaccaacggaaccctcgct
caatatgtagtcgtagaacgaactatgcttgctgtgctaccagaaggtgtgaaagttgag
gaagcggcaggcgtcggcatcgtcgggttgacagaataccaggcgctcgtgccaaatgtc
aagagcggcgacaaagtctttatcaacggcggctcaggcggaaccggcgtctttggcatt
caaatcgctaaagcgctgggctgccatgttaccactagttgctcaactcccaacattgag
ttttgccagagccttggtgcagacgaagttatagactacaagactacggatatcgttgag
gcgctgtctgccaaaggtcaggtctttagcaccgtggtagacaatgtcggtgcgcctgac
aacctgtacaaagcgtcatctgctttcctcctccccaagggcaaattcgtgcaagtcggg
atgcaacctagccttggtggtacgaagacgttggttagcaatatgcttctgccgggtttc
ctgggtggcggaaagagttcctttcagttaattatggctaagccgtctgcggagcaattg
aggcacatgagcgaatggcttaagaagggctcgttgaagccgattgtggatacagtgttt
gagtgggaggatgcacccaaggcttttgagaagctgaagacaggaagggcgaagggaaag
attgtgattagagtcccgcaagataaatcgaaggacaaggcagcggatggatcttcgtag

DBGET integrated database retrieval system