KEGG   Bipolaris zeicola: COCCADRAFT_108534Help
Entry
COCCADRAFT_108534 CDS       T03110                                 

Definition
(RefSeq) hypothetical protein
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
bze  Bipolaris zeicola
Pathway
bze00790  Folate biosynthesis
bze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bze00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    COCCADRAFT_108534
Enzymes [BR:bze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     COCCADRAFT_108534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PhoD PhoD_N ADH_zinc_N_2 ADH_zinc_N ADH_N Pur_ac_phosph_N Metallophos
Motif
Other DBs
NCBI-GeneID: 19143748
NCBI-ProteinID: XP_007717020
JGI: 108534
UniProt: W6Y113
Position
Unknown
AA seq 959 aa AA seqDB search
MLSLLLAVVPLASLVCASFDGNLNYHSPSRRHNDLGIDVPKVAKRTLSKRSAPWDPAQLN
FTHGVASGDPYPDSVILWTRIAPSLEHDRSNVTVSGYVALYNHETEKYIQASPNPICVDY
RVGTDSDLSTVVDEGQAYTTSDIDYTVKVEAKNLEPFTQYYYQFSVCGSSNKSPLGRTKT
SPDHDDDVSKVGFAVFSCSNWQNGYFNAYGNAARKDNVDFFVHLGDYIYESTKGKLGKDP
RATNPPREIVTLYDYRTRIGQYRTDDDLKLAHQNFAWIPTWDDHEIANNGYRDGFSNMNN
TEESFLKYGGISVDSRKMNAVRAYFEWMPIRQVDLDDNLRIWRNFKMGKLFDLIILDTRN
YDRSITTLDENDAYIETIRDDASRSLMGSRQENWFYNRLSESHERGATWRIVGNQIIFSR
MNNSAVYSDWLNADQWDGYTANRNRTLHHLYSNKIPNTAFLAGDSHANWVSDLVWLDETP
YDQATGEGAIGVEFAGTAVSSSGYGSGRSIANSTDRSAALVRDNRELQWTEGYYRGYYEL
FISPEELNAQYYGSPSVASRNPFDISLANFTVKAGANHLARTNGSVVAAGGYVESGALQR
GPTTPTNLTLNTVTGTWNITGIEQITNGGIEKNLQINESAPLPFLHDEQVLVQVHAMALN
PVDYKVTEGPMPLRLVGSNITPGADFCGTVAKVGRKVDEFQIGEFVFGAKVGALTNGTLA
QYVVVERTMLAVLPEGVKVEEAAGVGIVGLTEYQALVPNVKSGDKVFINGGSGGTGVFGI
QIAKALGCHVTTSCSTPNIEFCQSLGADEVIDYKTTDIVEALSAKGQVFSTVVDNVGAPD
NLYKASSAFLLPKGKFVQVGMQPSLGGTKTLVSNMLLPGFLGGGKSSFQLIMAKPSAEQL
RHMSEWLKKGSLKPIVDTVFEWEDAPKAFEKLKTGRAKGKIVIRVPQDKSKDKAADGSS
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgctctcgctcctacttgcggtcgttccgttggcttcgctcgtttgtgcatccttcgac
ggcaacttgaactaccactcgccttctcgtcggcacaatgatcttggaatagatgtaccc
aaagtcgcaaagagaactctttccaaacgctctgctccatgggacccggcccagctcaac
ttcacacatggtgttgcctctggagatccctaccctgactccgtcatcctctggacccgt
attgcaccctcgctcgaacatgacagatcaaacgttactgtttctggctacgtagcactc
tacaaccacgagacagaaaagtacatccaagcttcgccaaatcccatctgcgtcgactat
cgtgttggtacagacagcgacctctcaactgttgttgatgaaggacaagcatacaccacc
tccgacatcgactacactgtcaaggttgaagccaagaacttggagccattcacccagtac
tactatcaattcagtgtctgcggcagctccaacaaaagtcctctaggcagaaccaagact
agccctgatcatgacgacgatgtttccaaagtcggttttgcagtcttttcttgctccaac
tggcagaacggatatttcaatgcttatggaaatgctgcaagaaaggacaatgtggacttc
tttgttcatctgggcgattatatatacgagtctaccaaaggaaagctcggtaaagatcct
agagcaacgaatccgccacgcgagattgtcacactatacgactaccgaactagaattggc
cagtaccgtacggatgatgacttgaagcttgcccaccagaactttgcatggatccccaca
tgggacgaccatgaaattgccaacaacggataccgtgatgggtttagcaatatgaacaat
accgaagagagcttcttgaagtacggaggtatcagcgtcgactccagaaaaatgaacgct
gttcgagcatactttgaatggatgccgatccgccaggtcgatcttgatgacaacctccgc
atctggcgcaacttcaagatgggcaagctcttcgatctcatcatccttgatacccgcaac
tatgatcgatcaattacaaccctggatgagaatgacgcgtatatagaaacaatcagagat
gacgctagtcgctcactcatgggcagccgccaggaaaactggttctacaaccggctctcc
gagtcacatgaacgaggcgctacttggaggattgtcggtaaccagatcatcttttcgcgc
atgaacaatagtgcggtctacagcgactggctgaatgctgaccagtgggatggctacacc
gcaaaccgtaaccgtactctacaccatctctacagtaacaagatcccaaacactgcattc
ttggccggcgattcacacgccaactgggtttctgatctcgtttggctggacgaaacccca
tacgaccaggctacgggagagggtgcgattggagtcgagtttgctggcactgctgtctcc
tctagcggttacggctctggtagatcgattgcgaattcgaccgaccgctctgcagcgctc
gttcgtgacaacagggagcttcagtggacagagggttactaccgaggatactatgaactt
ttcatctcgcctgaagagctcaacgcgcagtactacggctctccttcagtcgcttctcgc
aaccctttcgacattagtctcgccaacttcactgtcaaggcgggcgctaaccacctggcg
aggactaatggctcggttgtggcagcgggcggatacgttgagagcggcgcgctccagcgt
gggccaacgactccaacgaatctgactctgaacactgttaccggcacgtggaatattacc
ggtatcgagcagatcacgaatggtggtatcgagaagaaccttcagatcaacgaatccgca
ccactacccttcctccacgatgaacaggtcctcgtccaagtccacgcaatggcactgaat
cccgtcgattacaaagtcaccgaaggccctatgccccttcgactcgtgggatccaacatc
accccgggtgctgatttctgcggcacagtggcaaaagtcggccgaaaagttgacgagttc
caaatcggcgaattcgtctttggcgcaaaagtcggtgcgctgaccaacggaaccctcgct
caatatgtagtcgtagaacgaactatgcttgctgtgctaccagaaggtgtgaaagttgag
gaagcggcaggcgtcggcatcgtcgggttgacagaataccaggcgctcgtgccaaatgtc
aagagcggcgacaaagtctttatcaacggcggctcaggcggaaccggcgtctttggcatt
caaatcgctaaagcgctgggctgccatgttaccactagttgctcaactcccaacattgag
ttttgccagagccttggtgcagacgaagttatagactacaagactacggatatcgttgag
gcgctgtctgccaaaggtcaggtctttagcaccgtggtagacaatgtcggtgcgcctgac
aacctgtacaaagcgtcatctgctttcctcctccccaagggcaaattcgtgcaagtcggg
atgcaacctagccttggtggtacgaagacgttggttagcaatatgcttctgccgggtttc
ctgggtggcggaaagagttcctttcagttaattatggctaagccgtctgcggagcaattg
aggcacatgagcgaatggcttaagaagggctcgttgaagccgattgtggatacagtgttt
gagtgggaggatgcacccaaggcttttgagaagctgaagacaggaagggcgaagggaaag
attgtgattagagtcccgcaagataaatcgaaggacaaggcagcggatggatcttcgtag

DBGET integrated database retrieval system