KEGG   Bipolaris zeicola: COCCADRAFT_24793Help
Entry
COCCADRAFT_24793  CDS       T03110                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bze  Bipolaris zeicola
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bze00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    COCCADRAFT_24793
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    COCCADRAFT_24793
Enzymes [BR:bze01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     COCCADRAFT_24793
Lipid biosynthesis proteins [BR:bze01004]
 Desaturase
  First
   COCCADRAFT_24793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 456 aa AA seqDB search
MATPDPQVAVPPTLPTQPHISTQPVTLQNWYKKINWLNTTLVVLIPIYGLYLSLSTPLTR
PTLLWSILYYATTAFGITGGYHRLWSHRCYSARLPLRIFLAFVGAGAIQGSIRWWSANHR
AHHRWTDTMKDPYSVMRGLLFSHIGWMVLNTDPKVKGRTDISDLDNDAIVVFQHKHYGKI
LIFTAWIFPALVAGLGWGDWWGGLVYAGIIRACLVQQATFCVNSLAHYLGEQPFDDRRSP
RDHVFTALVTMGEGYHNFHHEFPSDYRNAILWYQYDPTKWLIWGMSKIPFFPLTQDLKTF
RANEIEKGRLQQQQKAVDKKRAALDWGTPLSQLPVLSWDDFQTQASTNGAALVAIAGVIH
DISPFIADHPGGKTLIKSAIGKDATAVFNGGVYEHSNAAHNLLSTMRVGILRGGQEVEVW
KSSAERASKDVRGLGIVRAGEQATRVAAPATVATAA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggccacaccagacccacaagtggctgtgcctccaacactaccaacacagccacatata
tcaacccagcctgtgaccctgcaaaactggtacaagaagatcaattggctcaatacgaca
ctggtcgtcctcatcccaatctatggcctctatctttccctttctacacccctcacccgt
cctacactgctatggagcatcctttactatgccacaaccgcctttggtatcacaggcggt
taccatagattatggagtcaccgttgttactctgcacgtcttcctctacgcatttttctc
gcattcgtaggggccggtgccatccaaggaagcatacgctggtggagcgctaatcaccgc
gctcaccatcgttggactgataccatgaaagacccatattcggtcatgcggggtctactc
ttctcccacattggatggatggtcttaaacacggaccccaaagtgaagggacgtacggat
atttctgatctggacaacgacgccattgtcgttttccaacacaagcactatggcaagatt
cttatttttaccgcctggatctttcctgcattagtcgctggcctgggatggggagattgg
tggggaggtcttgtgtacgcaggcatcattcgagcgtgtctcgttcagcaagcgacattc
tgtgtcaattcgttggcacactatcttggagagcaaccgtttgatgaccgcaggagccct
agagatcatgtgtttaccgctctcgttaccatgggagaaggctaccacaactttcatcac
gaattccctagcgactaccgtaacgctatcctctggtaccaatacgaccccactaaatgg
ctgatctggggcatgtccaaaatccccttcttcccactaacccaagacctcaagacgttc
cgcgccaacgaaatcgaaaaaggccgtctccaacaacagcaaaaagctgtagacaagaaa
cgcgcagcactcgactggggcaccccgctttcccaactgcccgtcctctcctgggacgac
tttcaaacccaagcttctacaaatggcgccgcgctggtagctattgctggtgtcatccac
gacatctcgccttttatcgccgaccaccccggcggtaaaacactgatcaaatctgcgatt
gggaaagacgcaactgctgtatttaacgggggtgtgtatgaacactcaaatgcagcacac
aacctgctctcaacgatgagagtaggtattctgcgcggaggccaagaagtagaggtctgg
aaatcgagtgcggagcgggcgtctaaggatgttaggggtttaggtattgttcgggcgggt
gagcaggctacaagggtcgcggcgccggctactgtggctactgcggcgtga

DBGET integrated database retrieval system