KEGG   Coraliomargarita akajimensis: Caka_0132Help
Entry
Caka_0132         CDS       T01204                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
caa  Coraliomargarita akajimensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:caa00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Caka_0132
Enzymes [BR:caa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Caka_0132
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Caka_0132
Lipid biosynthesis proteins [BR:caa01004]
 Fatty acid synthase
  Component type
   Caka_0132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
163405..164082
Genome map
AA seq 225 aa AA seqDB search
MSYMQRRQLSGFDRPWFRVLFTIALMAVLSSVTVAGELSAAVPKRVLFFGDSLTAGYGLD
PSQAYPALVQVKIEQARVDASVHVGAVSGDTSAGGLRRIDWMLRQPVDVFVLALGANDGL
RGMDLEATEQNLQAILDRVKASYPEVQLVIAGMKMPPSLGAEYTEQFAAIYPQLAEANDA
VLIPFLLEGVGGVVELNLPDRIHPNAKGHKRVAQTVWESLAPLLR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacatgcaaagacgtcaactgtcaggtttcgatcggccttggttccgagttttg
ttcacgattgcgctgatggccgtgctgagttccgtcacggttgccggcgagctatctgcc
gcagtgcccaagcgagtactgttttttggagatagtttaacggctggttacgggctggac
ccttcacaagcgtatcccgccttggtgcaggtgaaaattgagcaggcacgtgtcgatgct
tcggttcatgtcggtgcggtgagtggcgatacgagtgcggggggcttgcggcgcattgat
tggatgttgcggcaaccggtggacgtgttcgtgctggcattgggcgctaacgacggcttg
cggggcatggatctggaagcgaccgagcaaaacctacaggcgattctggaccgtgtgaaa
gcgagttacccggaagttcagttggtgatcgcaggaatgaagatgccgccgagtctcgga
gcggagtataccgagcagtttgcggcgatctatccgcagctggcagaggccaatgacgca
gtgctcattccgtttttgctggagggggtcggaggtgtggtggagctgaatcttccagac
cgaattcatccgaatgcgaaggggcacaagcgcgtggcgcaaactgtttgggagagcttg
gcgcctttgttgcgctag

DBGET integrated database retrieval system