KEGG   Coraliomargarita akajimensis: Caka_0267Help
Entry
Caka_0267         CDS       T01204                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
caa  Coraliomargarita akajimensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:caa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
343499..344095
Genome map
AA seq 198 aa AA seqDB search
MTPAFEELLQQFKKLPGLGYRSAERIAMQLLVEKPESLERLLSSLQRAQQVVGRCEQCGN
LAEEGTCAVCTDERRDPQVLCVVEHVTDLMAIERSAAWKGQYHVLHGKLSPIHGVGPEDL
NFSALEKRLSAGSIREIVLALSNDIEGQATCHYIQEEIVGERAIQVSRIGFGLPSGGGVT
YADSVTLKSALEARRVYE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccagcattcgaagagctccttcagcagttcaagaaactgccgggcttgggctat
cgctccgccgagcgtattgcgatgcaactgctggtggagaagcctgaaagtctggagcgt
ttgctcagcagtctgcagcgggcgcaacaggttgttggtcgttgtgagcagtgcggcaac
ttggccgaggaaggcacgtgcgcggtttgtaccgatgagcggcgcgacccgcaggtgctg
tgcgtggttgaacacgtcacggatctgatggcgatcgagcgttcggctgcctggaaagga
cagtatcatgtattgcatggtaaactctctccgattcatggggtggggcctgaagatttg
aatttctctgcactcgagaagcgtttgagcgcaggctcgatccgtgagatcgtactcgcc
ttatccaacgacattgaagggcaggcaacctgtcactacatccaggaggagattgtcggt
gagcgtgcgattcaagtctcgcgcattggctttggcctgccgagtggtggtggggtgacc
tatgcggattcggtgacgctgaagagcgcactcgaagcgcgtcgggtctacgagtag

DBGET integrated database retrieval system