KEGG   Coraliomargarita akajimensis: Caka_0437Help
Entry
Caka_0437         CDS       T01204                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
caa  Coraliomargarita akajimensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:caa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Caka_0437
Enzymes [BR:caa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Caka_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
535905..536834
Genome map
AA seq 309 aa AA seqDB search
MTSAATPRLQFQSPAKINLFLAVHRRRDDGFHELSSLVAPLSFGDLLEVSICDGDQDHLS
CAQEGVPTGAENLILQAAQRFREATEGAQCFEFSLDKRIPMGAGLGGGSGNAATALRAMN
QLCHEPLSEHQLLGIAAELGSDCPLFLTGQPTLMRGRGEQLESLPADLVSELCGRKVLLF
KPDFPIATAGAYQRLIASAPHSYISEVAAGEQLEAFYGSRDLGALLYNSFEGPIGEKFIA
IPTLLNDLRSMGLACLMSGSGSCCFALPGDDSPSISEIKRYVTDAWGETVFFVETSIAAA
DTRSSARSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtgcagctactcctcgattacaatttcagtctccagcgaagattaatctcttc
ctcgcagtccaccgaaggcgggacgacggttttcatgaattgagctcattggtcgctccg
ctgagttttggcgatttgcttgaagtcagcatttgcgacggtgatcaggaccatctgagc
tgtgcacaagagggcgtacccactggagcggagaacctgattcttcaggcggcacagcgc
tttcgtgaggcgacggagggcgctcagtgtttcgaattcagcttggataagcgcattccg
atgggggctggactcggcggtggcagtggcaacgcggcgactgccttgcgtgccatgaat
caattgtgccacgagccactctctgagcatcagttactcgggattgctgctgaactcggt
tctgattgccccttgtttctcactgggcagccgacactgatgcgtgggcgtggcgagcag
ctcgaaagtttgcctgcagaccttgtaagtgaactgtgtggccgcaaggttctgctgttt
aagccggattttccgattgcaacagcgggagcctatcagcgcttaattgcctccgcgccg
cattcttatatctcggaagtcgctgcaggggaacagcttgaggcattttatggttctcgt
gatttgggcgcattgctgtacaattccttcgaagggccgattggggagaagtttattgcg
atccccactttactgaacgatctgaggtcgatggggctagcttgtttgatgagtggcagt
ggtagttgctgcttcgcgttaccgggtgatgacagcccaagtatcagcgagatcaaacgc
tacgttactgatgcctggggggaaacagtcttttttgttgaaacttcaatcgctgccgct
gacactcgcagttcggcgcggagccgctaa

DBGET integrated database retrieval system