KEGG   Coraliomargarita akajimensis: Caka_0672Help
Entry
Caka_0672         CDS       T01204                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
caa  Coraliomargarita akajimensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:caa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
861423..862526
Genome map
AA seq 367 aa AA seqDB search
MPKKKSAKNVSTKTSKPYKAPEFLVDLLEARSPTGHEYEAQAVIDRTIEPAVDEYRKDTM
GNRFATVNPGGDPSILFAGHIDELGLIITYINDKGFLYFDTLGGHDKSMISGRRVSILTQ
HGIVKGVTGKRAIHLMSPEDRKKVPETHEIWIDLGVKSKAEAEALVRIGDCAVYDQSFEL
INGSIGVARAFDDKAGAYAVLEAVRRLSTGKLAARVTAAATTQEEIGTRGAMTAAFSENP
DFAIAVDVGHATDSPDCDPRKYGQFIQGGGPIVCRGPNINPVIFERIVQVAEKEGIPYQL
EADPRPTGTDARAIQVAQAGIATGLLSIPLRYMHTPSEMVDLEDIENTVKLLVAVARSLK
KGERGVW
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaaagaagtctgcaaagaacgtatcgaccaagacatccaagccctacaaggcg
cccgaattcctcgttgatttactggaggcgcgctcgccgaccggtcatgaatatgaagca
caggcagtaatcgatcgtacgatcgagccggctgtcgacgaataccgcaaggataccatg
ggcaatcgctttgcgaccgtaaatcctggtggtgatccatcgattctctttgctggacac
atcgatgaattggggctgatcatcacctatatcaacgataagggctttctttatttcgat
accttgggtggacacgacaagtcgatgatctctgggcgacgtgtgtcgatcctaacccag
catggaatcgtcaaaggcgttacgggtaaacgtgcgatccacttgatgagtccggaagat
cgcaagaaggtgcctgagacacacgagatctggatcgaccttggcgtgaaatcgaaggct
gaggcagaagcactggtacgtatcggtgactgcgcagtctacgaccagagtttcgagctg
atcaatggtagcatcggtgtcgcgcgtgccttcgatgataaagcgggtgcgtatgcggta
ctcgaagcagtccgccgcttgtccacaggcaagctggcagctcgtgtgaccgcagcagcg
accacccaggaagaaataggcactcggggtgcaatgactgctgccttctcggagaatccg
gacttcgccattgcggttgatgtcggccatgcgaccgattcgcccgattgcgacccgcga
aagtatggtcagttcattcaagggggtggtccaattgtttgccgcggcccgaacatcaac
ccggtcatcttcgagcgtatcgtgcaggtcgcagagaaggagggcatcccgtatcagctt
gaagcggatccacgaccgaccggaacggatgcacgtgccattcaggtggcacaggccggt
atcgcgaccggtctgctttccatcccgctgcgctacatgcacaccccaagtgaaatggtt
gatctcgaggatatcgagaacacggtgaaacttttggtcgccgtagcacgctcgttgaag
aagggtgagcgcggcgtttggtag

DBGET integrated database retrieval system