KEGG   Coraliomargarita akajimensis: Caka_0735Help
Entry
Caka_0735         CDS       T01204                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
caa  Coraliomargarita akajimensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:caa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caka_0735
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Caka_0735
   00640 Propanoate metabolism
    Caka_0735
   00660 C5-Branched dibasic acid metabolism
    Caka_0735
Enzymes [BR:caa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Caka_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
945020..946216
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKRLLADYGVPVPKGYAAQTSREVETAISHLSDDQKIVVKAQIHAGGRGKGTF
VDGYKGGVKVVDGREAALEAAGHMLGNTLVTAQTSAAGRKVQTLYLTEACEIAHEYYLAI
VLDRETAQSVIIASTEGGMDIEEVADKTPEKIIRVPISPTMGLRHHHCRRVAFELGFEGD
QVKQFARILTGLYKLFWEKNAMLVEINPLITTPEGQVVALDAKVSFDGNAVFQHPDIMQL
RDLNEEDPKEVEASKYNLSYIALDGNIACLVNGAGLAMATMDIIKSFGGEPANFLDVGGG
ANEDQVTAAFKIILSDPNVEGILVNIFGGIMKCDVIARGIVAAAKNVELKVPLVVRLEGT
NVDAGKEILRESGVALTPADSLVEAAEIITKQVSEKNG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgagtatcaggcaaagcgccttctcgcggactatggtgtgccggtaccg
aaaggttacgccgcccagacctcccgtgaagtcgaaacagctatctcccacctaagcgat
gatcagaagatcgtcgtgaaggcccaaatccatgcagggggccgaggaaaaggcaccttt
gttgatggctataaaggaggcgttaaggttgttgatggccgcgaagctgcacttgaagcc
gcgggccacatgcttggcaacacactcgttaccgcacaaaccagtgcggcgggtcgtaag
gtgcagacactgtaccttaccgaggcctgtgaaatcgctcacgaatactatctcgcgatc
gtcctcgaccgcgagacagcacaatctgtaatcattgcctctactgagggtggtatggat
atcgaggaggtcgccgacaagaccccggagaagattatccgagtgccgatttccccaacc
atgggcctgcgtcaccatcactgccgccgcgttgcgtttgaactcggcttcgaaggtgac
caagtaaagcagttcgctcgcattctcacgggtctctataagctattttgggaaaagaac
gcgatgctggttgagatcaatccgctcatcaccacacccgaaggtcaggtggtcgcactc
gacgccaaggtttcctttgacggtaatgcagtcttccaacacccggacatcatgcagctc
cgcgacctcaacgaagaggatccaaaggaagtcgaagcgtccaagtacaacctcagctac
atcgctttggacggcaatatcgcctgcctggtgaatggtgccggtcttgcgatggcgacc
atggacatcattaagagctttggtggcgaacctgctaacttcctcgacgtcggtggtggc
gcgaacgaagatcaggtcacggcagcctttaaaatcattctttccgatccaaatgttgaa
ggtatcctcgtgaatatcttcggcggtatcatgaagtgtgacgtcattgctcgcggcatc
gttgcggcagctaagaacgttgaactcaaggtacctttggtggttcgtctcgaaggcacc
aatgtggatgctggtaaggaaatcctccgcgaaagcggcgttgccctaacaccagctgac
agcttggtggaagcagcggaaatcatcaccaagcaagtttccgaaaagaacggctaa

DBGET integrated database retrieval system