KEGG   Coraliomargarita akajimensis: Caka_1066Help
Entry
Caka_1066         CDS       T01204                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
caa  Coraliomargarita akajimensis
Pathway
caa00010  Glycolysis / Gluconeogenesis
caa00620  Pyruvate metabolism
caa00640  Propanoate metabolism
caa00680  Methane metabolism
caa01100  Metabolic pathways
caa01110  Biosynthesis of secondary metabolites
caa01120  Microbial metabolism in diverse environments
caa01130  Biosynthesis of antibiotics
caa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:caa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caka_1066
   00620 Pyruvate metabolism
    Caka_1066
   00640 Propanoate metabolism
    Caka_1066
  Energy metabolism
   00680 Methane metabolism
    Caka_1066
Enzymes [BR:caa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Caka_1066
Lipid biosynthesis proteins [BR:caa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Caka_1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADE54088
UniProt: D5EHP7
Position
complement(1350138..1352084)
Genome map
AA seq 648 aa AA seqDB search
METVSHEHRKFSPLPEFAEQARIGSMEAYEELYARSIADPEAFWAEAAQELHWFKPWDSV
LDESEKPFFKWFDGSRTNLSYNCLDRHVLEGRGAKTAIHWEGEPGDKRALSYSELLAEVC
RFANVMKRLGVQKGDRVAIYLPMIPELAVAVLACARIGAVHSVIFAGFSADSIRDRVLDS
QARMVITGDAGYRRGKILELKSVVDEGVANCDCISEVLVVRRESTVLGACQLQEGRDHWY
HELAAEVSDECPAEEMEAEDLLFLLYTSGTTGKPKGIMHTTAGYQVYSYYTAKYVFDLRE
DDIYWCTADIGWITGHSYIVYGILQNGATQLMYEGAPNHPDPSRFWQLVEAYNVTIFYTA
PTAIRAFMKWGDDWVTKYDLSSLRLLGTVGEPINPEAWMWYHERIGGGRCPIVDTWWQTE
TGGHMLTPIPGAVPTKPGCATLPFFGIEPLVLSEDDDEEVAVGILAIKKPWPGIMRGVYG
DPQRYKDTYWCKWNGAYYFPGDGARRDEDGYLWILGRVDDVVNVSGHRIGTAELESVFVE
HPDVAESAVIGVPHEIKGQGLMAFVTVIEGREHDAHLRHELVAMVDKSIGKFARPEKIIF
SSDLPKTRSGKIMRRLLRDIAEGRALGNTTTLADPGIVEALQHQFNAS
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggagacggtctcgcacgagcaccgtaagttttcgcccctacctgaattcgccgagcag
gcgcgcatcggcagcatggaggcctatgaggaactctatgcacgcagcattgccgacccg
gaagcattttgggccgaggcggcccaagagttacactggttcaagccatgggacagtgtc
ctggatgagtcggaaaagcctttcttcaagtggtttgatggcagtcggacgaatttatcc
tacaactgtttggatcgtcatgttcttgaagggcgtggtgcaaagactgcgattcactgg
gaaggcgagccgggcgataagcgtgcacttagctattctgagttgctggcagaggtgtgt
cgtttcgctaacgtcatgaagcgcttgggagtgcagaagggggatcgagttgcgatttac
ttgccgatgattccggagttggcggttgcggtcctcgcttgtgcccgaattggtgcggtg
cactcggtgatcttcgcgggtttctcggctgactctatccgggaccgtgtgctggatagt
caggctcggatggtgatcaccggcgacgcaggctaccgccgtggtaagattttggagctg
aagtcagttgtcgatgaaggtgtcgccaattgtgattgtatttccgaggttttggtggtt
cgtcgcgagtccacagttctaggagcctgccagttacaggaggggcgtgatcattggtat
cacgaattggctgcggaggtgtcggacgagtgccctgcggaagagatggaagccgaagat
ttgctctttttgctttatacgagcggtaccaccggtaagcccaagggcatcatgcatacc
actgctggttaccaagtgtatagctactacaccgcaaagtatgtcttcgatctgagggaa
gatgatatctactggtgtactgcggatattggctggatcaccggacacagttatatcgtc
tatggtatcctgcagaacggtgcgacgcagttgatgtatgagggcgccccgaatcatccg
gatccgagccgcttctggcaattggtcgaagcgtataatgtgacgattttctacacggca
ccgacagccattcgggcctttatgaagtggggcgatgattgggtcaccaagtacgacctg
agttcacttcgcttgttgggtacggtgggggagccgatcaatcctgaagcatggatgtgg
tatcatgagcgcatcggtggcgggcgctgtccaatcgtagatacctggtggcagactgaa
accggcgggcacatgctgactccaattcccggggcggtgccgaccaagccggggtgtgcg
acgctacccttctttggtattgagccattggtcttatcggaggacgatgacgaagaggtt
gcggttggtattttggcgatcaagaaaccttggccggggattatgcgtggggtgtatggt
gacccgcaacgctacaaggacacctattggtgtaagtggaatggagcgtattactttcca
ggtgatggggcgcgtcgtgacgaagatggttatctctggatccttgggcgtgtggatgat
gtcgtgaatgtctctgggcaccgtattgggaccgccgaacttgaaagcgtatttgttgaa
catccggatgtcgctgagtccgcggtcatcggtgtaccgcatgagatcaaaggacagggc
ttgatggcttttgtgacggttatcgaggggcgtgagcatgatgcccatttgcgtcatgag
ttggttgcgatggtggataagagcattggcaaatttgcacgtcccgagaaaattatcttt
tcctctgatttgcccaaaacgcgttctggtaaaatcatgcgccgcttgctgcgtgatatc
gctgaaggtcgagctttgggaaataccaccacacttgcagatcccggaattgtggaagcc
ttgcagcatcaatttaatgcgtcttag

DBGET integrated database retrieval system