KEGG   Coraliomargarita akajimensis: Caka_1092Help
Entry
Caka_1092         CDS       T01204                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
caa  Coraliomargarita akajimensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:caa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caka_1092
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Caka_1092
  Amino acid metabolism
   00310 Lysine degradation
    Caka_1092
Enzymes [BR:caa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Caka_1092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1379781..1381019
Genome map
AA seq 412 aa AA seqDB search
MATEVIIPAMGESISSGILAAWHVQDGDYVTAGQAIFELETDKITSEATAEVSGIIAIKI
EADEEVEIGEVVAVIDESAAAPEGSATPPSSESASEAAPAAEPVASPASAKVDVEATLSP
AARKAAAETGVDVKTLAGSGKDGRVTKGDILAAPTPASTPTPTAAPVPAVAATSPVVPAG
ERESRKKMTPLRRKIAEHLVNATQQSAMLTTFNEVDMSAVMKLRKAHQEDFVGRHGIKLG
FMSFFTKAVTHALQAVPEVNARIEGNEIVSQHYYDIGVAVGTDKGLMVPVIRDCDQKGFA
QIEQDILGYAKLAREGKIQMSDLEGGVFTISNGGIYGSMLSTPIINYPQPAILGLHNIQQ
RAVVVNGEIVARPMMYLALSYDHRLIDGKEAVTFLVKVKEAIEDPSRLLFGI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggctacagaagtaattattcccgcaatgggcgaatccatcagcagcggtatcctcgct
gcttggcatgtacaggacggcgactatgtcaccgccggtcaggcaatcttcgaactcgaa
accgataaaatcacttccgaggcaactgccgaagtttcgggtatcattgccatcaaaatt
gaagccgacgaggaagttgaaatcggcgaggtcgttgcggtcatcgacgagagcgccgca
gctcccgaaggctccgcgactcctccaagcagcgaaagcgccagtgaggcggcaccggcc
gcagagcccgtcgcatctcccgcctcagccaaggtggatgtcgaagccaccctatccccc
gcagctcgcaaagctgctgctgaaaccggagtggatgtaaagacgctagccggcagcggc
aaggacggtcgagtgacaaagggtgacatactcgcagcaccgacaccggccagtacgcca
acaccgacggcagctccagtgcctgcagtcgcagcgaccagtccagtggtcccagccggc
gaacgcgaaagccgcaagaaaatgactcctctgcgtcgtaagatcgcagagcatctggtc
aatgcgactcaacagtctgcaatgctgacgaccttcaacgaagtcgatatgagcgcagtg
atgaagctgcgcaaggcgcaccaagaagacttcgtcggccgccatggcatcaagcttggc
ttcatgtccttctttaccaaagcggtgactcatgcgctgcaagcggtaccggaggtcaat
gcccgcatcgaaggcaacgagatcgtgtcccaacactattatgacatcggtgtcgccgtc
ggcaccgacaagggactgatggtaccagtcattcgcgactgcgatcaaaagggcttcgcg
cagatcgaacaagacattctcggctacgcaaaactggcccgtgagggtaaaatccaaatg
agtgacctcgaaggtggtgttttcaccatatccaacggtggtatctacggctccatgctg
agcaccccgatcatcaattatcctcaacctgcaattctaggtctccacaatatccagcag
cgcgctgtcgtggtgaacggtgaaatcgttgcccgtccaatgatgtatctggcactcagc
tatgatcaccgtctgatcgacggcaaggaagcggtcaccttcctcgtcaaagtgaaggaa
gccatcgaggatccaagccgcctcttgttcggaatctaa

DBGET integrated database retrieval system