KEGG   Coraliomargarita akajimensis: Caka_1423Help
Entry
Caka_1423         CDS       T01204                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
caa  Coraliomargarita akajimensis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:caa00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:caa00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1775828..1777132
Genome map
AA seq 434 aa AA seqDB search
MQYFDCDKIQYEGPSSKNPLAFKHYNPEELVDGKPMKEHLRFAAPYWHVMRNELADPFGG
GTAQMPWDDGSNSTENALKRVDVFFEFLEKIGIDYYCWHDRDIAPELSDLSASNAALDAV
VAKLKEKQKETGVKLLWGTACLFSHPRYSQGGATSPDMNVFTYAAAQVKKALECTKELDG
LGYTFWGGREGYATLLNTDMKRELDHLAAFLHMAVDHAKKIGFDGPFYIEPKPREPSTHQ
YDSDSAACLNFLREYGLMDKFRLNIETNHATLAGHTMEHELTVAMNANMLGSIDANRGDE
LIGWDTDQFPTDIYLTTQVMLCVLEMGGFTTGGLNFDAKRRRESHEPIDLMHAHIGGMDA
FARGLKIAAAIREDGRLANFVKDRYSSFDSDLGAKIEAGNCSFDELEKLALSAGEPSLAS
GRQEMLENLVNEFL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacttcgactgcgataaaatccaatacgaaggacctagttccaagaacccgctt
gcgttcaagcattacaacccggaagagcttgtcgacggcaagccaatgaaggagcacctg
cgttttgcagctccgtactggcacgtcatgcgcaacgagctggctgacccatttggtggc
ggcactgcgcaaatgccatgggatgacggttcgaactccaccgaaaacgcactcaagcgc
gtcgacgtcttctttgagttccttgaaaagattggcatcgactactactgctggcacgac
cgtgacatcgctccggaactcagcgacctctccgcttccaacgcggccctcgacgcggtg
gtagccaagctcaaggaaaagcaaaaggaaaccggcgtgaagctcctctggggtactgcc
tgcctgttctcccacccacgctactcccagggcggtgctacctccccggacatgaacgtc
ttcacctatgcagcagcacaggtgaagaaggcccttgagtgcaccaaggaactggacggt
ctcggttacactttctggggcggccgcgaaggttacgcgacactgctcaacaccgacatg
aagcgcgaactcgaccaccttgcagccttcctgcacatggcagtcgaccacgcgaagaag
atcggtttcgacggcccgttctacatcgagccaaagccacgcgagccatccactcaccaa
tacgattccgactccgcagcctgcttgaacttcctgcgtgagtacggtttgatggacaag
ttccgcctgaacatcgaaaccaaccacgccacactggctggccacacaatggagcacgag
ctcactgtggccatgaatgccaacatgctgggcagtatcgatgcgaaccgcggtgacgaa
ctcatcggctgggacaccgaccaattcccaaccgacatctacctgaccacacaagtaatg
ctttgtgttctggaaatgggtggtttcaccacaggtggcctgaactttgacgccaagcgc
cgtcgcgagtcccatgagccaattgatctcatgcacgcgcacatcggcggtatggacgcc
tttgcacgcggcttgaagattgcagctgccatccgcgaagatggtcgcctcgcaaacttc
gtcaaggaccgctacagcagcttcgacagcgacctcggagccaagatcgaagccggcaac
tgcagcttcgacgagctcgaaaagcttgcactgtctgctggtgaaccgtctttggccagt
ggccgtcaggaaatgctcgaaaacctggttaacgagttcctgtaa

DBGET integrated database retrieval system