KEGG   Coraliomargarita akajimensis: Caka_1423Help
Entry
Caka_1423         CDS       T01204                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
caa  Coraliomargarita akajimensis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Caka_1423
   00051 Fructose and mannose metabolism
    Caka_1423
Enzymes [BR:caa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Caka_1423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1775828..1777132
Genome map
AA seq 434 aa AA seqDB search
MQYFDCDKIQYEGPSSKNPLAFKHYNPEELVDGKPMKEHLRFAAPYWHVMRNELADPFGG
GTAQMPWDDGSNSTENALKRVDVFFEFLEKIGIDYYCWHDRDIAPELSDLSASNAALDAV
VAKLKEKQKETGVKLLWGTACLFSHPRYSQGGATSPDMNVFTYAAAQVKKALECTKELDG
LGYTFWGGREGYATLLNTDMKRELDHLAAFLHMAVDHAKKIGFDGPFYIEPKPREPSTHQ
YDSDSAACLNFLREYGLMDKFRLNIETNHATLAGHTMEHELTVAMNANMLGSIDANRGDE
LIGWDTDQFPTDIYLTTQVMLCVLEMGGFTTGGLNFDAKRRRESHEPIDLMHAHIGGMDA
FARGLKIAAAIREDGRLANFVKDRYSSFDSDLGAKIEAGNCSFDELEKLALSAGEPSLAS
GRQEMLENLVNEFL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacttcgactgcgataaaatccaatacgaaggacctagttccaagaacccgctt
gcgttcaagcattacaacccggaagagcttgtcgacggcaagccaatgaaggagcacctg
cgttttgcagctccgtactggcacgtcatgcgcaacgagctggctgacccatttggtggc
ggcactgcgcaaatgccatgggatgacggttcgaactccaccgaaaacgcactcaagcgc
gtcgacgtcttctttgagttccttgaaaagattggcatcgactactactgctggcacgac
cgtgacatcgctccggaactcagcgacctctccgcttccaacgcggccctcgacgcggtg
gtagccaagctcaaggaaaagcaaaaggaaaccggcgtgaagctcctctggggtactgcc
tgcctgttctcccacccacgctactcccagggcggtgctacctccccggacatgaacgtc
ttcacctatgcagcagcacaggtgaagaaggcccttgagtgcaccaaggaactggacggt
ctcggttacactttctggggcggccgcgaaggttacgcgacactgctcaacaccgacatg
aagcgcgaactcgaccaccttgcagccttcctgcacatggcagtcgaccacgcgaagaag
atcggtttcgacggcccgttctacatcgagccaaagccacgcgagccatccactcaccaa
tacgattccgactccgcagcctgcttgaacttcctgcgtgagtacggtttgatggacaag
ttccgcctgaacatcgaaaccaaccacgccacactggctggccacacaatggagcacgag
ctcactgtggccatgaatgccaacatgctgggcagtatcgatgcgaaccgcggtgacgaa
ctcatcggctgggacaccgaccaattcccaaccgacatctacctgaccacacaagtaatg
ctttgtgttctggaaatgggtggtttcaccacaggtggcctgaactttgacgccaagcgc
cgtcgcgagtcccatgagccaattgatctcatgcacgcgcacatcggcggtatggacgcc
tttgcacgcggcttgaagattgcagctgccatccgcgaagatggtcgcctcgcaaacttc
gtcaaggaccgctacagcagcttcgacagcgacctcggagccaagatcgaagccggcaac
tgcagcttcgacgagctcgaaaagcttgcactgtctgctggtgaaccgtctttggccagt
ggccgtcaggaaatgctcgaaaacctggttaacgagttcctgtaa

DBGET integrated database retrieval system