KEGG   Coraliomargarita akajimensis: Caka_1437Help
Entry
Caka_1437         CDS       T01204                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
caa  Coraliomargarita akajimensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:caa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Caka_1437
Enzymes [BR:caa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Caka_1437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1794385..1794984
Genome map
AA seq 199 aa AA seqDB search
MIARLKGTVDESTPLLVVLDVKGVGYEVHIPVTTAEQIPAVGETCNLFIHSVYREDSATL
YGFASREDRDFFRLLVEKVSGIGPKIGISILSRMSVNVLQAAIASSDVALLSKCPGIGKK
TAERLVIELKDKVYTQAPSSNTSSKHNANPDTSSAFQDAVGSLTTLGYKNADADKLIRKA
AQRIGTDASVEDLIREALK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattgcccgcctaaaaggtaccgtggacgaatccacgccactgctcgtcgtgcttgac
gtaaagggtgtcggctatgaagtccacattccggtaaccaccgctgaacagatccctgca
gtcggtgaaacatgcaacctgttcatccactccgtctatcgagaggacagcgccacactc
tatggtttcgccagccgcgaggaccgggatttcttccgcctcctcgtcgagaaggtatcc
ggcattggccccaaaatcggcatcagcattctgagccgcatgtcggtgaatgtgctccaa
gcggcaatcgcaagtagcgatgtcgcgctcctctccaaatgcccgggaattggtaaaaaa
accgccgagcggcttgtcattgagctgaaagataaggtgtacactcaagcgccatcgagc
aacaccagctctaagcataatgccaacccagatacatcatccgccttccaggatgcagtc
ggcagcttgacgacgcttggctacaaaaatgcggatgccgataagcttatccgaaaagcg
gctcaacgcatcggaaccgacgcctcagtcgaggatctcatccgcgaagcactcaagtaa

DBGET integrated database retrieval system