KEGG   Coraliomargarita akajimensis: Caka_1743Help
Entry
Caka_1743         CDS       T01204                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
caa  Coraliomargarita akajimensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:caa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Caka_1743
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Caka_1743
Enzymes [BR:caa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Caka_1743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2124517..2125314
Genome map
AA seq 265 aa AA seqDB search
MDKLTEIMAAKARQIEHLIRPVRDSELEQFAGMRKQGGSFLEALAQPDRLSVIAEIKRKS
PSAGQIAEAGLDAVEQARKYVNAEADCFSVLTDTDYFGGKLQDLWDVVEFLEVHQRTTPC
LRKDFMIHPIQVLEAAEAGARCILIIVRALEDDQIKALYEAATLAGLDSLFEIHEESELE
KALKFGPKIVGVNNRDLKRFKTDLAVSELLIPQIPDDIIKVSESGIFEPEDAERASACGA
DAILVGEALMRAEDPEELVEAFHNA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggataaactcaccgaaatcatggccgctaaggcgcggcagatcgaacatttgattcgc
cccgtgcgcgactcagagctcgagcaattcgccggcatgcgcaaacaaggcgggagcttt
ctcgaagcactcgcccaaccggaccgtttatctgtcatcgccgagatcaaacgcaaatct
ccatccgccgggcaaatagccgaggcgggccttgacgcagtcgaacaggcacgcaagtac
gtgaatgcggaggccgattgcttctcagtgctcaccgacaccgattactttggtggcaaa
ttacaggatctctgggatgtcgttgagttcctcgaggtacaccaacgcaccacgccctgc
ctgcgcaaggacttcatgatccacccgatccaagtactggaggcagcagaagccggggca
cgctgcattctaatcatcgtccgcgccttggaagacgatcagatcaaagcactctacgag
gctgccacactggctggactggacagtttgttcgaaatccatgaagagagcgagctcgag
aaggcactcaaattcggaccgaaaattgtcggcgtcaacaatcgcgaccttaagcgcttc
aagaccgatttagccgtatccgaactattgataccacaaatcccagacgacatcatcaaa
gtcagcgaaagtggtatctttgaaccggaggacgccgaacgcgccagcgcctgcggggca
gacgccatccttgttggcgaggcactgatgcgcgccgaagaccccgaggaactggtcgag
gcctttcacaacgcctga

DBGET integrated database retrieval system