KEGG   Coraliomargarita akajimensis: Caka_2312Help
Entry
Caka_2312         CDS       T01204                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
caa  Coraliomargarita akajimensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:caa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caka_2312
   01230 Biosynthesis of amino acids
    Caka_2312
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caka_2312
   00030 Pentose phosphate pathway
    Caka_2312
   00051 Fructose and mannose metabolism
    Caka_2312
   00052 Galactose metabolism
    Caka_2312
  Energy metabolism
   00680 Methane metabolism
    Caka_2312
Enzymes [BR:caa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Caka_2312
Protein phosphatases and associated proteins [BR:caa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Caka_2312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2831010..2832272
Genome map
AA seq 420 aa AA seqDB search
MSEVLEGNCLIAQSGGPTSVINASLAGAVTEALNHECIEEIYGGLNGVLGILNEQIVDLA
AESQQTIRALRHTPGAALGTCRFKLKRQEDYDRVLEVFEAHNIRYFFYAGGNDSQDTADK
ISKLAQERGYALRVIGIPKTIDNDLVTTDHTPGYGSVIKYIAATVKEISCDNAAMGQHDL
VQIVEVMGRSAGWIAAGAALAKRRDDPSAAPHLIYLPEVAFTPEKFIADVQHVLQKEKYC
VVVVGEGLVDPDGNFVSTDSAGADAFGHSQLGGAGEYLRGLVEESLQIKARSIKLGMAQR
AAVHCSSQADNDEAFMAGEAAVQAAIAGETDKMVTLVRAEADSYKCETGLAPLSEIANGV
KKLPESWINEDGTSMSYQFYKYALPLIQGEVQVPYENGVPVLAQLRCDKVQRQLAPHVFE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagtacttgaaggaaattgccttatcgcccaatccggcggcccgacatctgta
atcaacgcgagcttggctggcgcggttaccgaagcacttaatcacgagtgcattgaagaa
atttacggaggcttgaacggtgttctgggtatcctgaacgagcagatcgtcgacctcgcc
gcggaatcgcaacagacgattcgtgcgctgcgtcacactccgggggccgccttgggtacc
tgccgtttcaaactgaagcgccaagaggactatgaccgcgtgctcgaggtgtttgaagcg
cacaatatccgttacttcttctatgctggtggtaatgactctcaggacacggcggacaag
atttccaagctcgctcaagagcgtggctatgcgctgcgtgtgattggtattccaaagacc
atcgataatgatttggtcacgacggaccacacacccggctacggctcggtaatcaagtac
atcgccgcgacggtaaaggagatttcctgtgataatgcagcaatgggccagcatgacctt
gtgcagatcgttgaggttatggggcgtagcgcaggctggattgccgcaggcgctgccttg
gcaaagcgccgtgacgatccgtccgccgcgccgcatttgatctatctcccggaagtggcg
ttcactccggagaagttcatcgctgatgttcagcacgtcctgcaaaaggaaaagtactgt
gtcgttgtcgtgggtgaaggtctggttgatccggatggtaattttgtttccactgattct
gccggtgcggatgccttcggtcactcgcagttgggtggtgcaggtgagtatctccgcggc
ttggtcgaggagagtctgcagatcaaggcacgttccattaagcttggtatggcgcagcgc
gctgcagtacactgttcctctcaggcggacaacgatgaggccttcatggccggtgaagcc
gcggttcaggcagcaattgctggtgaaactgacaagatggtaactttggttcgcgccgag
gccgatagctacaagtgcgaaactgggcttgcgccactgtcggagatcgccaacggcgta
aagaagcttccagaaagctggatcaatgaggacggtaccagtatgagctaccagttctat
aagtatgccttgccactgatccaaggtgaagttcaggtgccgtatgagaacggtgtacca
gttctcgcgcaactccgttgcgacaaggttcagcgccagttggcgccgcacgtatttgag
taa

DBGET integrated database retrieval system