KEGG   Coraliomargarita akajimensis: Caka_2357Help
Entry
Caka_2357         CDS       T01204                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
caa  Coraliomargarita akajimensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:caa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Caka_2357
  Amino acid metabolism
   00340 Histidine metabolism
    Caka_2357
Enzymes [BR:caa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Caka_2357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2885166..2886461
Genome map
AA seq 431 aa AA seqDB search
MQKLEYSDTPKFSQALRTFCDQATVSGDVSAVVTGVLADIRAHGDKAVLQYTEQFDGAKL
SAKAMRVDPAELKAAEKTLSVADRKAIRESIAMVKEYHKKTLPKAWTAKNAQGATIGERF
YPIQRVGLYIPGGNVPLVSTVIMTAVLAKLVKNPEIAVCTPPAADGSIAPGMLAALSMVG
VDEVYKVGGVQAIGAMAYGTRTVPAVDKIFGPGNAFVMEAKRQVLGTVGIDLLPGPSEVM
VIADAGATAAHVAADLIAQAEHGSGKEIIYFATTSKALLQKVEKAIAKQIPERSHADKIA
KVMAQRFLAVHCKKLDQCAAVANYIAPEHLELQVADKSLATLTQKITTAGAILQGYMTPT
VLGDFTSGPSHTLPTGRAGRFFSGLQAIDFMRRSSIVRYNAKSLAKAAPVVETFARLEQL
DAHGHSLKIRL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagctcgagtattctgatacgccaaaattcagtcaggccctgcgcacgttttgt
gatcaggcaaccgtatctggtgacgtctctgcagtcgttaccggtgtgcttgccgatatc
cgagcgcacggagacaaggcggttctacagtatacggagcagtttgatggtgcgaagctc
agtgcgaaagccatgcgtgtcgatcctgctgagttgaaagcagcagagaagaccttgtcg
gttgctgatcgcaaagcgattcgcgagtcgattgcaatggtcaaggagtaccacaagaag
actttacctaaggcatggaccgcaaagaacgcccaaggagcgacgatcggcgagcgtttt
tatccaatccagcgcgtgggcttgtatattcctggaggcaacgtgccgctggtatcgact
gttatcatgactgcggtgcttgccaagctggtgaagaacccagagatcgccgtgtgtacg
ccgcccgccgcggatggttcgatcgcgcccggaatgctcgcggccctgtcgatggttggc
gttgatgaagtgtacaaggtcggcggtgttcaagcgattggtgcgatggcttatggtacg
cgaacggtacctgctgtggataagatttttgggccgggcaatgcctttgtgatggaggcc
aagcgtcaggtgttgggtacggttgggattgatctcttgcccgggccgagcgaggtgatg
gtcatcgcagatgcaggtgccactgcagcgcatgtggcggcggatttgattgctcaggcc
gaacacggtagcggcaaggaaatcatctattttgcgaccaccagcaaggcgctcttgcaa
aaggtggagaaggccatcgcgaagcaaattcccgaacgctcgcacgcagacaaaattgcc
aaagtcatggctcagcgtttcttggcggtgcactgcaagaaattggatcagtgcgcggcg
gtggccaactatattgcgccggaacacttagagttgcaggttgcagacaagtcactggcg
acgctgacccaaaaaattaccaccgcgggagccattttgcagggctacatgacgccaact
gtcttgggtgattttacttcgggcccgagtcacaccttgccaactggtcgcgccgggcgc
ttctttagcggcttgcaggcaatcgactttatgcgtcgctcgagtatcgttcggtacaat
gccaagagcttggcaaaggcggcgccagtggttgaaacctttgctcgtttggagcagttg
gatgcgcacgggcactcattgaagatccgtttgtag

DBGET integrated database retrieval system