KEGG   Coraliomargarita akajimensis: Caka_2607Help
Entry
Caka_2607         CDS       T01204                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
caa  Coraliomargarita akajimensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:caa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Caka_2607
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caka_2607
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Caka_2607
Enzymes [BR:caa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Caka_2607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3162051..3163424
Genome map
AA seq 457 aa AA seqDB search
MTNDICWMQFISTRGQVPPVSFSTAVEQGLAPDGGLYLPEQLPDLAPYLSEWEGKSYAEI
CEAFFALFATDIDRDELHAIVQRSYTKFDDPEIAPIKQLSEDCSVLELFHGPTLAFKDFA
LQLLGNLYEAQIARTGRPISVLGATSGDTGAAAIHGLLGKQGVKTFILYPDGRISALQER
QMTCTGADNVFPLAIKGSFDDAQAAMKTVFEDREFAAEVGLSAVNSINLARILAQCVYYL
SAFFRLPAEKREQVTFVVPTGNFGNVLAGWLVQQMNVPIKGFRVATNQNDILHRLFDTGT
YELDAVAPSLAPSMDIQVASNFERFLYYAVDCNAEKVREIISTFKESGKYVFENFSADTF
SSSRTDDTEIGEIIQRVHDTFGYVIDPHTACGFAGDFAGPELVLSTAHPAKFPETIQAAI
GVDSTHPSLEALKAETIVKHHVDPTPEAIKAFMRERV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgacatctgctggatgcaatttatcagcacacgcggccaggtgccgcccgtt
tcgttttccactgcggttgagcaagggctcgctccggatggcggtctctacttgcctgaa
caattgccagaccttgcgccctatctctcggagtgggagggcaagagttatgcagagatt
tgtgaagcattctttgcactctttgcgacggatatcgaccgtgacgaattgcatgctatc
gttcagcgttcttacaccaagtttgatgatcctgagatcgctccgatcaagcaactgagc
gaagactgctctgtgttggaactctttcatgggcccaccttagcgttcaaggattttgcg
ctgcagctcttggggaacctgtacgaagctcagattgcgcgtacagggcggccaatctcg
gtgctgggcgcaacttcgggtgataccggtgcggcagcgattcatggattgctcggcaag
caaggtgtgaagacctttattttgtacccagatggtcgtatctctgcgttgcaggagcgt
cagatgacttgtacgggtgcggacaatgtcttcccgctggcaatcaagggaagctttgat
gatgctcaggcggcgatgaagacggtcttcgaagatcgtgagtttgcggctgaagtcggt
ctttccgcggtgaattcgattaacttggcacgcatccttgcgcagtgcgtttactatctc
tctgcgttcttccgcctgccggctgaaaagcgcgagcaggtgaccttcgtggtgccaacc
ggcaattttggaaatgtgcttgcgggctggttggtgcagcaaatgaatgtaccaatcaaa
ggctttcgggtcgcgaccaatcagaatgacattctgcatcgcctcttcgatacaggtacc
tacgagctggatgcagttgctccaagtctcgcgccgtcgatggacattcaggttgcgtcg
aattttgagcgcttcctttactacgcggtggattgtaacgctgaaaaggtacgcgagatt
atttcgacctttaaggagagcgggaagtatgtcttcgagaacttcagtgcggataccttc
agtagttcccgcacagatgatacggagatcggtgaaatcattcaacgggtgcatgatacc
tttggctatgtcattgatccgcatacggcttgtggtttcgcaggcgattttgccggacct
gaactcgtcctctcgacggcacatcctgcaaaattcccggagaccattcaggccgcaatc
ggagtggattccacacacccctctttggaggcgctcaaggccgagacgatcgtcaagcat
catgtcgatccgactcccgaggcgatcaaggccttcatgcgcgagcgcgtttag

DBGET integrated database retrieval system