KEGG   Coraliomargarita akajimensis: Caka_2993Help
Entry
Caka_2993         CDS       T01204                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
caa  Coraliomargarita akajimensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:caa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caka_2993
   01230 Biosynthesis of amino acids
    Caka_2993
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caka_2993
   00051 Fructose and mannose metabolism
    Caka_2993
   00562 Inositol phosphate metabolism
    Caka_2993
Enzymes [BR:caa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Caka_2993
Exosome [BR:caa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Caka_2993
  Exosomal proteins of bladder cancer cells
   Caka_2993
  Exosomal proteins of melanoma cells
   Caka_2993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3611038..3611805
Genome map
AA seq 255 aa AA seqDB search
MSRKYLIAGNWKMNLVPAEGAALVKEIAGLVGSETAVDICVSPTFTALDAVSKEVAGSQV
TVGAQNMHFEASGAYTGEISADMLKAVSVQYVILGHSERREYFGETDADVNKKTIAALAA
GLKPIVCVGETLEEREAGKVTEVIKTQTEAALAGVTAAQADELVIAYEPVWAIGTGKTAT
PEMAEEVHAEIRCLLAGLLGEEAAEKVRILYGGSMKPENADDLLAQKNIDGGLIGGASLK
APSFASLVESAAKLS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtaaatacctaatcgctggtaactggaagatgaaccttgtgcccgctgaaggc
gcagctctggtgaaggaaatcgctggtctagtcggttccgaaactgcagtggatatttgt
gtcagcccaacctttactgcgctcgacgcggtatcgaaggaagtcgctggttcccaagtc
acagtgggtgcacagaatatgcacttcgaagcatccggtgcctacactggagaaatctcg
gctgacatgctgaaagcggtgtctgttcaatacgtgatccttggtcactccgagcgacgc
gagtacttcggtgaaactgacgcggatgtaaacaagaagactatagctgcactcgctgct
ggcttgaagccgattgtttgtgttggtgaaacactcgaagagcgtgaagcagggaaggtg
actgaagtcatcaagactcaaactgaagctgcgcttgcgggtgtgactgctgcgcaagca
gatgagcttgttatcgcatacgagccagtttgggcaatcggtacggggaagactgcaact
cctgaaatggctgaagaagttcatgccgagattcgttgtctgcttgccggtttgcttggt
gaagaagccgctgaaaaggttcgtatcctttatggtggttccatgaagcccgagaatgct
gacgatctgctggcgcaaaagaacatcgacggcggtttgatcggtggtgcttcgctgaag
gccccatctttcgcaagtctcgtcgaaagtgcagcgaagcttagctag

DBGET integrated database retrieval system