KEGG   Coraliomargarita akajimensis: Caka_2993Help
Entry
Caka_2993         CDS       T01204                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
caa  Coraliomargarita akajimensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:caa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caka_2993
   01230 Biosynthesis of amino acids
    Caka_2993
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caka_2993
   00051 Fructose and mannose metabolism
    Caka_2993
   00562 Inositol phosphate metabolism
    Caka_2993
Enzymes [BR:caa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Caka_2993
Exosome [BR:caa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Caka_2993
  Exosomal proteins of bladder cancer cells
   Caka_2993
  Exosomal proteins of melanoma cells
   Caka_2993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3611038..3611805
Genome map
AA seq 255 aa AA seqDB search
MSRKYLIAGNWKMNLVPAEGAALVKEIAGLVGSETAVDICVSPTFTALDAVSKEVAGSQV
TVGAQNMHFEASGAYTGEISADMLKAVSVQYVILGHSERREYFGETDADVNKKTIAALAA
GLKPIVCVGETLEEREAGKVTEVIKTQTEAALAGVTAAQADELVIAYEPVWAIGTGKTAT
PEMAEEVHAEIRCLLAGLLGEEAAEKVRILYGGSMKPENADDLLAQKNIDGGLIGGASLK
APSFASLVESAAKLS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtaaatacctaatcgctggtaactggaagatgaaccttgtgcccgctgaaggc
gcagctctggtgaaggaaatcgctggtctagtcggttccgaaactgcagtggatatttgt
gtcagcccaacctttactgcgctcgacgcggtatcgaaggaagtcgctggttcccaagtc
acagtgggtgcacagaatatgcacttcgaagcatccggtgcctacactggagaaatctcg
gctgacatgctgaaagcggtgtctgttcaatacgtgatccttggtcactccgagcgacgc
gagtacttcggtgaaactgacgcggatgtaaacaagaagactatagctgcactcgctgct
ggcttgaagccgattgtttgtgttggtgaaacactcgaagagcgtgaagcagggaaggtg
actgaagtcatcaagactcaaactgaagctgcgcttgcgggtgtgactgctgcgcaagca
gatgagcttgttatcgcatacgagccagtttgggcaatcggtacggggaagactgcaact
cctgaaatggctgaagaagttcatgccgagattcgttgtctgcttgccggtttgcttggt
gaagaagccgctgaaaaggttcgtatcctttatggtggttccatgaagcccgagaatgct
gacgatctgctggcgcaaaagaacatcgacggcggtttgatcggtggtgcttcgctgaag
gccccatctttcgcaagtctcgtcgaaagtgcagcgaagcttagctag

DBGET integrated database retrieval system