KEGG   Coraliomargarita akajimensis: Caka_2993Help
Entry
Caka_2993         CDS       T01204                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
caa  Coraliomargarita akajimensis
Pathway
caa00010  Glycolysis / Gluconeogenesis
caa00051  Fructose and mannose metabolism
caa00562  Inositol phosphate metabolism
caa01100  Metabolic pathways
caa01110  Biosynthesis of secondary metabolites
caa01120  Microbial metabolism in diverse environments
caa01130  Biosynthesis of antibiotics
caa01200  Carbon metabolism
caa01230  Biosynthesis of amino acids
Module
caa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:caa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caka_2993
   00051 Fructose and mannose metabolism
    Caka_2993
   00562 Inositol phosphate metabolism
    Caka_2993
Enzymes [BR:caa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Caka_2993
Exosome [BR:caa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Caka_2993
  Exosomal proteins of bladder cancer cells
   Caka_2993
  Exosomal proteins of melanoma cells
   Caka_2993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADE56006
UniProt: D5ERG2
Position
3611038..3611805
Genome map
AA seq 255 aa AA seqDB search
MSRKYLIAGNWKMNLVPAEGAALVKEIAGLVGSETAVDICVSPTFTALDAVSKEVAGSQV
TVGAQNMHFEASGAYTGEISADMLKAVSVQYVILGHSERREYFGETDADVNKKTIAALAA
GLKPIVCVGETLEEREAGKVTEVIKTQTEAALAGVTAAQADELVIAYEPVWAIGTGKTAT
PEMAEEVHAEIRCLLAGLLGEEAAEKVRILYGGSMKPENADDLLAQKNIDGGLIGGASLK
APSFASLVESAAKLS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtaaatacctaatcgctggtaactggaagatgaaccttgtgcccgctgaaggc
gcagctctggtgaaggaaatcgctggtctagtcggttccgaaactgcagtggatatttgt
gtcagcccaacctttactgcgctcgacgcggtatcgaaggaagtcgctggttcccaagtc
acagtgggtgcacagaatatgcacttcgaagcatccggtgcctacactggagaaatctcg
gctgacatgctgaaagcggtgtctgttcaatacgtgatccttggtcactccgagcgacgc
gagtacttcggtgaaactgacgcggatgtaaacaagaagactatagctgcactcgctgct
ggcttgaagccgattgtttgtgttggtgaaacactcgaagagcgtgaagcagggaaggtg
actgaagtcatcaagactcaaactgaagctgcgcttgcgggtgtgactgctgcgcaagca
gatgagcttgttatcgcatacgagccagtttgggcaatcggtacggggaagactgcaact
cctgaaatggctgaagaagttcatgccgagattcgttgtctgcttgccggtttgcttggt
gaagaagccgctgaaaaggttcgtatcctttatggtggttccatgaagcccgagaatgct
gacgatctgctggcgcaaaagaacatcgacggcggtttgatcggtggtgcttcgctgaag
gccccatctttcgcaagtctcgtcgaaagtgcagcgaagcttagctag

DBGET integrated database retrieval system