KEGG   Coraliomargarita akajimensis: Caka_3000Help
Entry
Caka_3000         CDS       T01204                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
caa  Coraliomargarita akajimensis
Pathway
caa00900  Terpenoid backbone biosynthesis
caa01100  Metabolic pathways
caa01110  Biosynthesis of secondary metabolites
caa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:caa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Caka_3000
Enzymes [BR:caa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Caka_3000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C GFO_IDH_MocA Sacchrp_dh_NADP NAD_binding_3 Semialdhyde_dh Ldh_1_N DapB_N
Motif
Other DBs
NCBI-ProteinID: ADE56013
UniProt: D5EHX3
Position
complement(3619383..3620549)
Genome map
AA seq 388 aa AA seqDB search
MPEPKKVVLLGATGSIGTSTLQVLRAHPDRLQLVGVASRTRHQELAAICHEFGVEHAVIT
NERAYQAARELSHFPATTQLACGHEALTELATLADADIVLVAVVGACGLKPALAAIEAGK
DIALANKELLVLGGAFVIEAARRKGIRLLPTDSEHNAIFQCIEGHPQEHLHQLILTASGG
QFRETPIADLSTVTPTQATQHPNWSMGPKITVDSATMANKGLELIEAHWLFGLPAEKLQV
TIHPQSIAHSFVQFVDGSILGQFSPPSMTFAIQHCLLYPDRAPGVHQTLDFAEAMQWDFR
SPDFARYPCLQLAYDALRAGNCAPAIFNAANEIAVERFLNGEIRYLDIPAVIDNALQSIP
SMTPSTIDDLFAIDQQTREHAHDFKPHN
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaccgaagaaggtcgtcctgctcggtgccactggctccatcggcaccagcaca
ctgcaggttctccgcgcacatccggaccgcctgcaattggtcggggttgcatcgcgcacg
cgtcatcaagagctcgccgccatatgccatgagttcggagtcgagcacgcagtcattacc
aatgagcgtgcctatcaagctgcacgggagcttagccatttcccagccaccacacagctc
gcctgtgggcacgaagccctgaccgaactagcgactctcgctgatgccgacattgtgctg
gtcgccgttgtcggcgcctgtggactgaaacccgcgctcgccgccatcgaggcaggtaag
gacatcgcactggcgaacaaagagcttctggtcctcggcggggcctttgtcatcgaggcg
gcacgccggaagggcattcgcctcctccccaccgacagcgagcacaacgcgatctttcag
tgcatcgagggccacccccaagagcacctgcatcaattgatcctcaccgcctcgggagga
cagtttcgagagacaccaatcgcagatttaagcactgtgacgccgactcaggcaacgcag
catccgaactggtcgatgggaccgaaaatcaccgtcgactctgccaccatggcgaacaag
ggtctggaactcatcgaagctcattggcttttcggcctcccagcggagaaactacaggtc
accattcacccacaaagcatcgcgcactcatttgtgcaattcgtcgatggctccatcctc
gggcaattcagtccgccctcaatgaccttcgcgattcagcactgtctgctctatccggac
cgcgcaccgggcgtccaccagaccctcgacttcgccgaagccatgcagtgggactttcgc
tcgcccgacttcgcccgatacccctgccttcaacttgcttacgatgcacttcgggctggg
aactgtgcccccgcaatcttcaatgcggccaacgaaatcgccgtggaacgctttctgaac
ggggaaatccgctacctcgacattcccgccgtcattgacaacgccttacaatccatacct
tcaatgactcccagcacgatcgatgaccttttcgccatcgaccaacaaacccgggaacac
gcacacgacttcaagcctcacaactag

DBGET integrated database retrieval system