KEGG   Chlamydophila abortus: CAB168Help
Entry
CAB168            CDS       T00242                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cab  Chlamydophila abortus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cab00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cab00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
179419..180753
Genome map
AA seq 444 aa AA seqDB search
MAAAEVFGGCVLEGSVRVSGAKNSTTKLLVASLLSDRKCVLRNVPDIGDVRLTVELCRSL
GSIVHWDKQAEVIEIHTPEIHMSEVSAQFSRVNRIPILLLGALLARCPEGVVVPCVGGDA
IGERTLNFHFEGLEQLGAKVAYDGHGYQAAAPKGLIGAYITLPYPSVGATENLILASVRA
QGRTIIKNAALEVEILDLILFLQKAGVEITTDNDRTIEIFGCEDFYEVDHWVIPDKIEAA
SFGMAAVLTGGRVFVENAEQHLMIPFLKTLRSIGGGFSVTETGIEFFYNEPLKGGVVLET
DVHPGFLTDWQQPFSVLLSQAEGSSVIHETVHENRLGYLRGLQKMGANCELFYQCLSSKA
CRYATGNFPHSAIIHGVTPLKASQLVIPDLRAGFAYIMAALIAEGGPSLIKNTQLLDRGY
YNWVDKLNSLGAKIHLLSLDPVAF
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagctgaagtttttggtggttgtgtgttagaaggttctgtgcgggtatccggg
gcaaaaaactctacaaccaagttgcttgttgcgtcattattatcggatcgcaaatgcgtt
ttgcgtaatgtccctgatataggagatgtacgtttaactgttgaattgtgccgttcttta
ggttctatcgtacattgggataaacaagcagaagtcatagaaattcatacgcctgagatt
catatgtccgaagtatccgcacagttttctcgggtaaatcgtattcctattttattatta
ggagctttacttgctcgttgtccggaaggtgtcgttgttccttgtgttgggggagatgct
ataggggaaaggacgctaaattttcattttgagggtttggaacagctaggagccaaagtt
gcctatgatgggcatggataccaagctgctgctcctaaaggtcttatcggagcttatatt
actcttccttatccttccgtaggagctacggagaatttgatactcgcttctgtccgtgct
caaggcagaacaatcatcaagaatgctgctttagaagtagaaatcttggatcttattttg
tttttacaaaaagcaggagtggagattacgacagataatgataggactatagaaattttt
ggttgtgaggatttttatgaagtagatcattgggtgatccctgataagatagaagccgct
tcgtttggcatggctgctgtacttaccggagggcgcgttttcgtagaaaatgccgagcaa
catctgatgattccctttcttaaaaccttacgctctataggaggagggttttcagtcaca
gaaacaggaatcgaatttttttataacgaaccattaaaaggtggtgttgtattagaaacc
gacgtacatcctggattccttacagattggcaacaacctttttcagttcttctctcccag
gcagaaggatcttctgtgattcatgaaactgtgcatgagaaccggctagggtatttacgc
ggtttacagaaaatgggagccaattgcgaactgttctaccagtgtttaagctcaaaggct
tgccgttatgcaacaggcaatttcccccatagtgcgatcattcacggagtcacaccattg
aaagcttctcaacttgttattcccgatttgcgtgcgggttttgcctatattatggcagcg
ctcattgcagagggcggcccatccttaatcaaaaacacccagttgttagatcggggatat
tacaattgggtagacaaactgaactctttaggagcaaaaatccacttattgtctttagat
cccgtggctttctaa

DBGET integrated database retrieval system